SecReT6
Protein ID: 525816140
SecReT6 ID820
T6SS typei3
Gene symbol-
Locus tagSEEH1578_10455
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. 41578
Repliconchromosome [GenBank: NC_021810] [Browse all T6SS(s) in this replicon]
Location [Strand]2114613..2115155 [+]
Producthypothetical protein
NoteTssB
UniProt IDS5H142
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.00E-60, Aligned region: 11..163
Protein Sequence: 180 a.a.     [Download]
>gi|525816140|ref|YP_008246158.1| hypothetical protein SEEH1578_10455 [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDRKFLDIDIDNF
NERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKA
GAENLVNKLLQDPTLLKTLANAPKPAATQQGVSADNESAE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|525814190|ref|NC_021810.1|:2114613-2115155 Salmonella enterica subsp. enterica serovar Heidelberg str. 41578, complete genome
ATGGCTATCAACAATAGCGCGCAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGCAGATTGAATATG
ACGTAGAGATTTACGGTTCCGAGAAAAAAATCGAGCTGCCGTTCGTGATGGCGGTGCTGGCCGATCTGGC
CGGGAAACCGCGTGAAGAACTGCCGCCGGTGACGGATCGCAAATTCCTCGATATTGATATTGATAACTTC
AATGAGCGCATGAAAGCCATTGCGCCGCGCGTGGCGTTCGCTGTGCCGAATACGCTGACGGGTGAAGGTC
AGTTGATGGTCGATATCACGCTGGAAAATATGGACGACTTTTCGCCGGCACAGATTGCCCGCAAGGTGGA
CGCCCTGAACCAGTTACTGGAAGCCCGCACCCAACTGGCGAACCTCCAGACCTACATGGATGGTAAGGCC
GGGGCGGAAAATCTGGTCAATAAACTGTTGCAGGACCCGACCCTGCTGAAAACGCTGGCGAATGCGCCGA
AACCGGCCGCTACCCAGCAAGGTGTGTCAGCGGATAATGAATCAGCGGAATAA