SecReT6
Protein ID: 525816147
SecReT6 ID820
T6SS typei3
Gene symbol-
Locus tagSEEH1578_10490
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. 41578
Repliconchromosome [GenBank: NC_021810] [Browse all T6SS(s) in this replicon]
Location [Strand]2119559..2120044 [+]
ProductProtein hcp1
NoteTssD
UniProt IDS5H3B6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-42, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|525816147|ref|YP_008246165.1| Protein hcp1 [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLSFEHYIDRASPNLF
KYCSSGKHIPQAILVMRKAGGNPLEYLKYTFTDLIIAMVSPSGSQGGEIASRESIELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
 
Nucleotide Sequence: 486 bp     [Download]
>gi|525814190|ref|NC_021810.1|:2119559-2120044 Salmonella enterica subsp. enterica serovar Heidelberg str. 41578, complete genome
ATGTCTTATGACATTTTTCTGAAAATTGACGGCATTGACGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGTCTCGG
TTCCGGTAAGGTCTCCGTCACTAATCTTTCATTTGAACATTACATCGATCGCGCCAGCCCGAACCTGTTC
AAATACTGCTCTTCCGGTAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTACACTTTCACAGATCTGATTATTGCAATGGTATCGCCCAGCGGAAGCCAGGGAGG
GGAAATTGCGTCTCGCGAATCAATTGAGCTCTCCTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCGAACAAAGAAATTTAA