SecReT6
Protein ID: 525816148
SecReT6 ID820
T6SS typei3
Gene symbol-
Locus tagSEEH1578_10495
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. 41578
Repliconchromosome [GenBank: NC_021810] [Browse all T6SS(s) in this replicon]
Location [Strand]2120112..2120648 [+]
Producthypothetical protein
NoteTssJ
UniProt IDS5GU51
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-41, Aligned region: 20..170
Protein Sequence: 178 a.a.     [Download]
>gi|525816148|ref|YP_008246166.1| hypothetical protein SEEH1578_10495 [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
MNKWRNPTRRLCAVAMPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKN
DAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYK
IPEAPEKAWYSSFIPGKGKVQLEAELEQSAIVITERDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|525814190|ref|NC_021810.1|:2120112-2120648 Salmonella enterica subsp. enterica serovar Heidelberg str. 41578, complete genome
GTGAATAAATGGCGTAACCCCACTCGGCGGTTATGTGCGGTAGCTATGCCTTTTGCACTGCTCCTGCTTT
CCGGATGCGGCAGTAGCGATGCGTTACCTGACCTCGAATCACAGCGACTCGACCTGAGCGTGAAAGCCTC
CGATAAGGTGAATCCTGACAATCAGAAGAAGGCCGCGCCCATTGAGATACGTGTTTATGAACTAAAAAAT
GACGCCGCTTTCACGACAGCTGATTACTGGTCGCTCCATGACAACGACAAATCCGTCCTTACCGACGATT
TAGTGCGTCGCGACAGCTTTATTTTGCGTCCCGGCGAAGAGAAAAAACTGCGTCGCCCGCTGAATGCGCA
GACCACGGCAATCGGCGTACTGGCCGGATACCGTAACCTGGCCAAATCGGTCTGGCGGGTAACCTACAAA
ATCCCGGAAGCCCCGGAAAAAGCCTGGTACAGCAGCTTCATACCGGGGAAAGGAAAAGTGCAGTTGGAGG
CGGAACTGGAACAAAGCGCCATTGTAATTACGGAACGGGATAAATGA