SecReT6
Protein ID: 525816150
SecReT6 ID820
T6SS typei3
Gene symbol-
Locus tagSEEH1578_10505
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. 41578
Repliconchromosome [GenBank: NC_021810] [Browse all T6SS(s) in this replicon]
Location [Strand]2121992..2123296 [+]
Producthypothetical protein
NoteTssL
UniProt IDS5H153
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.60E-61, Aligned region: 62..266
OmpA [PF00691], Evalue: 4.90E-16, Aligned region: 193..211
OmpA [PF00691], Evalue: 4.90E-16, Aligned region: 328..426
Protein Sequence: 434 a.a.     [Download]
>gi|525816150|ref|YP_008246168.1| hypothetical protein SEEH1578_10505 [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
MTDSTLTPPAADMMSFLSTTPEHKDSEYETPVHTSQRTELNVIVEDGPDSKLRLAEISAAANPLLAAARP
LLCALAAMPAKLDAALVEPYRNLLVREMHLYQTLCDQANLRREHVLAVRYCLCTALDEAANNTTWGRRGI
WAGKSLLVTFHGESEGGIKLFQIIGRLAASFQEHGNVLEVIYHLLGLGFEGRYSVQPDGRKQLDNIRQQL
LTQLSQRRDPVMPALSPDFQGAISGRLRRMRRVPVWLSAGIALLAMLTLFGLYSHRMDVQTVTVQQHIDA
IGIKLPPPPVPVHKLRLKILLANEIARGLLTVDEDDQHSRVVFRGDAMFVPGQKTVSDAIRPVINKAARE
IARVGGAVTVTGHTDSQPIHSAEFPSNLVLSEKRAAEVAALLTSGGVPAGRVHIVGKGDTVPVADNGSKA
GRAKNRRVEILVVE
 
Nucleotide Sequence: 1305 bp     [Download]
>gi|525814190|ref|NC_021810.1|:2121992-2123296 Salmonella enterica subsp. enterica serovar Heidelberg str. 41578, complete genome
ATGACAGACAGTACCCTGACGCCGCCAGCGGCGGACATGATGTCCTTTTTGTCCACCACGCCGGAGCATA
AGGACAGTGAATATGAAACGCCGGTACACACCAGCCAGCGCACGGAACTCAATGTCATCGTTGAAGACGG
TCCGGACAGCAAACTCCGGCTGGCTGAAATCAGCGCGGCGGCTAACCCGTTGCTCGCCGCTGCCCGGCCT
TTATTGTGCGCTCTCGCAGCCATGCCCGCTAAACTGGATGCGGCCCTGGTAGAGCCTTACCGTAATCTGT
TGGTACGCGAGATGCATCTGTACCAGACATTATGCGATCAGGCGAACCTGCGGCGCGAGCACGTACTGGC
GGTACGTTACTGCCTGTGTACGGCGCTTGATGAAGCCGCCAATAACACAACCTGGGGACGGCGCGGCATC
TGGGCCGGAAAAAGCCTGCTGGTAACATTTCATGGTGAAAGCGAAGGCGGGATAAAACTTTTCCAGATCA
TCGGGCGTCTGGCGGCCAGCTTCCAGGAGCATGGCAACGTACTGGAGGTTATCTACCACCTGCTGGGGTT
GGGATTTGAAGGCCGCTACAGCGTGCAGCCAGACGGGCGTAAGCAACTGGACAATATTCGCCAGCAACTG
CTGACACAGCTTTCACAGCGTCGCGATCCGGTAATGCCCGCGCTCTCGCCTGACTTTCAGGGGGCGATAA
GCGGACGACTGCGGCGGATGCGCCGGGTGCCGGTCTGGCTGAGCGCCGGGATAGCCCTGTTGGCGATGCT
GACGCTGTTTGGCCTTTACAGCCACCGGATGGATGTGCAGACCGTCACCGTACAACAGCATATTGATGCG
ATTGGTATAAAACTGCCGCCGCCGCCCGTGCCGGTTCATAAGCTGCGGCTGAAAATCCTGCTGGCAAACG
AAATCGCCCGTGGCCTGCTGACCGTGGACGAAGATGACCAGCACAGTAGGGTGGTCTTCCGTGGCGACGC
CATGTTTGTGCCGGGACAGAAAACGGTGAGTGACGCAATCCGGCCAGTGATTAACAAAGCGGCGCGGGAA
ATCGCCCGCGTGGGCGGCGCAGTCACTGTAACGGGTCACACTGACAGCCAGCCCATTCATTCGGCTGAAT
TCCCATCCAACCTGGTGCTGTCGGAAAAACGGGCGGCGGAAGTTGCGGCGTTGCTGACCTCCGGCGGCGT
ACCTGCCGGACGGGTACATATCGTCGGCAAGGGCGATACGGTGCCGGTGGCGGATAACGGCAGTAAAGCC
GGGCGGGCGAAAAACCGTCGGGTGGAAATTCTGGTAGTGGAGTGA