SecReT6
Protein ID: 525827686
SecReT6 ID821
T6SS typei3
Gene symbol-
Locus tagCFSAN002069_07690
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069
Repliconchromosome [GenBank: NC_021812] [Browse all T6SS(s) in this replicon]
Location [Strand]817070..819301 [+]
Producttype VI secretion protein Vgr
NoteTssI
UniProt IDS5HXV8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.80E-80, Aligned region: 120..428
Phage_GPD [PF05954], Evalue: 6.80E-80, Aligned region: 632..646
Phage_base_V [PF04717], Evalue: 9.30E-26, Aligned region: 466..558
Protein Sequence: 743 a.a.     [Download]
>gi|525827686|ref|YP_008250373.1| type VI secretion protein Vgr [Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069]
MSFVSTNNKSGIGGLTTTTPPITGESGGVTADSVAGSVADAAEAAVEQAAGSLFGALPEPSGLVKAAVAA
AQAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGGETLSELFSYVVQLKTPDTLNL
GYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWLKLLTHTSDYK
AFQNKSVVDILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLV
LADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRETG
HATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLMQ
TLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQEIWTDQYGRVKV
QFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWGL
PGAATQSGIYSHTIGGGPTNANALRFEDKPGSEEVWLHAEKDQRIEVNNNESHWVGNNRVKVIDQSEIAT
IGAVRDHKVQYDDTSLAGGNKTIQTVKELYLAAGDSITLSCGDTVLYMSSKGEFYVTCKTFNITATDADG
QINTIKGQLDLNMDKREPKVGTFGESEKTAMAAVIKETFPPKE
 
Nucleotide Sequence: 2232 bp     [Download]
>gi|559996969|ref|NC_021812.2|:817070-819301 Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069, complete genome
ATGAGTTTTGTATCCACAAATAATAAATCCGGTATAGGAGGGCTGACGACAACCACGCCGCCGATAACCG
GAGAAAGTGGCGGTGTCACCGCAGATTCAGTCGCCGGAAGCGTGGCAGATGCGGCGGAAGCCGCCGTGGA
ACAGGCTGCGGGATCGCTGTTTGGCGCATTGCCGGAGCCATCAGGACTGGTGAAAGCCGCGGTGGCAGCG
GCGCAGGCCGCCGCCGCAGGTATGGCGCAGGATGCGGTATCGGCCATCGTCTCCGCTGTTGCAGGCGGGC
CGGGGGCGCATAATGTGACGGTCAGCGGCAGCGCCGTACCGCCGGGCGCATTACTGTTCGCCAGCCTGGA
CGGCGGCGAAACATTAAGTGAACTGTTCAGCTATGTGGTACAGCTAAAAACGCCCGACACCCTGAATCTG
GGCTATGTCTCCCCGGCGGCCAACCTGCCGCTCAAACCGATGGTGGGCAAAGATCTGTGCGTCAACATCG
AACTGGATGGTGGCGGTAAACGACATATCAGCGGGCTGGTCACGGCGGCGCGGGTGGTGGGCCATGAAGG
GCGTTCGGTTACCTATGAGCTACGTATGGAGCCGTGGCTGAAACTGCTGACCCATACCAGCGACTACAAA
GCATTCCAGAATAAAAGCGTGGTGGATATTCTGGATGAAGTGCTGGCGGAATACCCCTACCCGGTGGAAA
AGCGGCTGGTGGAAAGCTACCCGGTACGCACCTGGCAGGTGCAGTACGGTGAAACTGATTTTGATTTTCT
TCAGCGACTGATGCAGGAGTGGGGCATCTATTGGTGGTTTGAGCACAGCGAGGACAGCCACACGCTGGTG
CTGGCGGATGCCATCAGCGCCCACAAAGCATGTCCGGACTCGCCGCTGGTCGAGTGGCACCAGGAAGGGC
TGAAGCTGGACAAGGAGTTTATCCACACTATCACGGCAAACGAGAGTCTGCGGACTGGACAGTGGGTGCT
GGATGATTTCGATTTTACGAAGCCACGTTCATTGCTGGCAAACACGGTGGCAAACCCGCGTGAAACCGGT
CATGCCACCTACGAGCATTATGAGTGGCCGGGAGACTACTTCGACAAGAGTGAAGGCGAGATGCTGACGC
GCATTCGTATGGAAGCGCAGCGCAGCCCCGGCAGTCGGGTGCTGGGGGGAGGGAATATCCGCACACTCAT
GACCGGTTATACCTTCACGCTGGAAAACTATCCCACTGCCGAAGTCAATCAGGAATACCTGCTGATGCAG
ACCTTGCTGTTTGTGCAGGACAACGCGCAGCACAGCGGGCAGGACCAGCACTTTACCTTTTCCACCCGTT
TTGAACTGCACCCCACCCGCGAGGTGTTCCGCCCGCAGCGGACGGTGAGCAAACCCCACACCAAAGGGCC
GCAGAGCGCCATCGTCACCGGCCCGGCGGGCCAGGAAATCTGGACGGATCAGTACGGGCGGGTAAAGGTA
CAGTTTGGCTGGGATCGCTACGGCAAAATGGATGAAAACAGCTCTTGCTGGATACGCGTCAGCTACCCAT
GGGCGGGCAAAGGCTTCGGGATGATCCAGATCCCGCGTATCGGCCAGGAAGTGCTGGTGGATTTCAAAAA
CGGCGATCCGGATCTGCCGATCATCGTGGGGCGTACCTACAACCAGGACACCATGCCGCCGTGGGGACTG
CCGGGCGCGGCAACACAGAGCGGGATATACAGCCACACTATCGGCGGCGGACCGACCAATGCCAACGCCC
TGCGTTTTGAAGATAAACCCGGTAGTGAAGAGGTCTGGCTACATGCTGAAAAAGATCAGCGTATTGAAGT
TAATAATAATGAAAGTCACTGGGTGGGGAATAATCGGGTTAAGGTCATTGATCAGTCAGAAATAGCCACT
ATTGGCGCTGTCCGCGACCATAAAGTTCAGTATGACGATACCTCTCTGGCCGGAGGAAATAAAACCATTC
AGACGGTAAAAGAGTTATATCTGGCAGCGGGTGATTCTATTACTCTGAGTTGTGGTGACACCGTTCTGTA
CATGAGCAGTAAGGGGGAATTTTACGTAACCTGTAAAACGTTCAATATTACTGCAACAGATGCCGATGGT
CAGATTAATACTATAAAAGGGCAGCTGGATTTAAATATGGATAAAAGAGAACCCAAAGTGGGAACATTTG
GTGAGTCAGAAAAAACAGCAATGGCAGCAGTAATTAAGGAAACTTTCCCACCCAAAGAATAG