SecReT6
Protein ID: 525827696
SecReT6 ID821
T6SS typei3
Gene symbol-
Locus tagCFSAN002069_07760
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069
Repliconchromosome [GenBank: NC_021812] [Browse all T6SS(s) in this replicon]
Location [Strand]803022..803507 [+]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDS5HXW6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|525827696|ref|YP_008250387.1| Hcp1 family type VI secretion system effector [Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069]
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
 
Nucleotide Sequence: 486 bp     [Download]
>gi|559996969|ref|NC_021812.2|:803022-803507 Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069, complete genome
ATGGCTTATGACATTTTTCTGAAAATTGACGGCATCGACGGTGAGTCGATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATCCATCAGGAATCCACCATGCACGCCGGTAGCGGCCTCGG
CTCCGGTAAGGTCTCCGTCACCAACCTGGATTTTGATCACTATATCGACCGCGCCAGCCCGAACCTGTTC
AAATACTGCGCCTCCGGCAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTATACCTTCACCGACCTGATTGTCGCCGTGGTTTCCCCGAGCGGCAGCCACGATGG
TGAAATCGCCTCCCGTGAAACGGTAGAGCTTTCTTTCAGCACTGTGAAACAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACTATCACCGCAGGTTACGATTTCAAGGCGAACAAAGAAATTTAA