SecReT6
Protein ID: 525827697
SecReT6 ID821
T6SS typei3
Gene symbol-
Locus tagCFSAN002069_07775
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069
Repliconchromosome [GenBank: NC_021812] [Browse all T6SS(s) in this replicon]
Location [Strand]800426..801934 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDS5HY31
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.50E-191, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|525827697|ref|YP_008250390.1| EvpB family type VI secretion protein [Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069]
MANSNMQATDAVAQDTVSASGEFDTLLNQAFRPKTTQAAKAVEAAVQTLAQQALANTITVSDDAYKSISA
IIAQIDFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWD
QSPMFKKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQE
LANPRDLTKIVTQNLEYAPWNSLRASEDSRYIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYV
WSNAAYAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKN
GFIPLIHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKER
EDMQRWLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRL
VTKLPSVKQGNA
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|559996969|ref|NC_021812.2|:800426-801934 Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069, complete genome
ATGGCAAACAGTAATATGCAGGCAACCGACGCGGTTGCTCAGGATACCGTCTCCGCATCCGGTGAATTTG
ATACGTTGCTGAATCAGGCCTTCCGACCCAAGACTACCCAGGCGGCAAAAGCCGTGGAAGCCGCGGTGCA
GACGCTGGCGCAACAGGCGCTGGCGAACACGATCACCGTCAGCGATGACGCCTATAAAAGCATCAGCGCT
ATTATTGCGCAGATCGACTTTAAACTGACCGAACAGATCAAACTGATCCTGCAACATCCCGACTGGCAGA
AGCTGGAATCCTCGTGGCGCGGTATGGAGCATCTGGTTTACAACACCGAGACCGACGAAAAGCTGAAAAT
TCGCTTCATGAATCTGTCAAAAGATGAATTGCGGCGCAACATGAAGCGTTACAAGGGCATCGCCTGGGAT
CAAAGCCCGATGTTCAAGAAACTGTATGAAGCCGAATACGGCCAGTTAGGTGGCGAACCTTATGGCTGTA
TCATTGCGGATTACTACTTCGACCATACACCGCCCGATGTGGATCTGCTTGGCTCTATCGCCAAAGTCGC
CGCGTCGGCCCATGCGCCGTTTATTGCCGGGGCTTCCCCCTCGGTACTGCAAATGGACTCCTGGCAGGAA
CTGGCGAATCCCCGCGACCTGACCAAAATCGTCACCCAGAACCTGGAATATGCGCCGTGGAACTCGCTGC
GGGCTAGCGAAGACTCCCGTTATATTGGCCTGACGATGCCGCGTTTTCTTGCCCGCCTGCCGTATGGCGC
AAAAACCAACCCGGTGGACGAGTTTGATTTTGAAGAAGATGCGGATGGTTCTGACCATACCAAATACGTC
TGGAGCAACGCGGCCTACGCGATGGGCGTAAACATCAACCGTTCCTTCAAACACTACGGCTGGTGTACGT
TGATTCGCGGTGTGGAATCAGGCGGTGCGGTGGAAAATCTTCCCTGCCATACCTTCCCGACTGACGATGG
CGGCGTGGACATGAAATGCCCGACCGAAATCGCCATCTCTGACCGCCGCGAGGCTGAACTGGCGAAAAAC
GGTTTTATCCCGTTGATCCACCGTAAAAACTCAGACTATGCCGCCTTTATCGGCGCACAGTCGCTGCAAA
AACCACAGGAATACTACGATCCGGACGCGACGGCCAACGCTAACCTGTCTGCCCGTCTACCGTACCTGTT
CGCCTGCTCGCGCTTCGCTCACTTCCTCAAATGTATCGTCCGCGACAAAATCGGTTCCTTTAAAGAGCGT
GAGGATATGCAGCGCTGGCTAAATGAATGGATTATGAATTATGTCGACGCCGATCCGGTGAACTCCTCGC
AAGAAACTAAAGCCCGTCGTCCGCTGGCTGCCGCTGAAGTAGTGGTGGAAGAGGTCGAAGGCAATCCAGG
TTATTACGACGCGAAATTCTTCCTGCGTCCGCATTTCCAGCTTGAAGGGCTGACGGGATCGCTGCGCCTG
GTGACAAAACTGCCGTCAGTGAAGCAGGGCAATGCCTGA