SecReT6
Protein ID: 525827701
SecReT6 ID821
T6SS typei3
Gene symbol-
Locus tagCFSAN002069_07795
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069
Repliconchromosome [GenBank: NC_021812] [Browse all T6SS(s) in this replicon]
Location [Strand]795040..795864 [-]
Producthypothetical protein
NoteTagJ
UniProt IDS5HXW9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.10E-46, Aligned region: 143..266
Protein Sequence: 274 a.a.     [Download]
>gi|525827701|ref|YP_008250394.1| hypothetical protein CFSAN002069_07795 [Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069]
MKKTDTLPATLSALIQEYSFAEGIQMAEQQVRENPAKALCRHSLFQLLCVAGDWSRALHQLQLCARMEAN
YTQEARLYRELVRCEMFRHTVFQGEQRPGFLLPQPVWVESLLAALACHDDTGEVDKHRNTALEAITDTGG
QWNGGAFDWASDSDSRLGPVLELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWL
FTRYSGSESASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMAHCTFHAQENDGA
 
Nucleotide Sequence: 825 bp     [Download]
>gi|559996969|ref|NC_021812.2|:c795864-795040 Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069, complete genome
ATGAAAAAAACTGACACGCTTCCTGCTACCCTGTCCGCGCTGATACAGGAATACTCTTTTGCGGAGGGGA
TTCAGATGGCGGAGCAGCAGGTTCGGGAAAATCCGGCGAAAGCGCTCTGCCGCCACAGCCTGTTTCAGTT
GCTGTGTGTGGCCGGAGACTGGTCGCGGGCGCTACACCAGCTTCAGCTATGCGCCAGGATGGAGGCCAAT
TATACCCAGGAGGCCCGGCTGTACCGGGAGCTGGTTCGCTGCGAAATGTTCCGCCACACCGTTTTTCAGG
GTGAACAACGACCCGGTTTTCTTCTGCCGCAGCCCGTTTGGGTGGAGTCACTGCTGGCGGCACTCGCCTG
TCATGACGATACCGGTGAGGTTGATAAACACCGTAATACCGCACTGGAAGCCATAACAGATACTGGCGGA
CAGTGGAACGGCGGCGCATTTGACTGGGCGAGCGACAGCGATTCCCGCCTTGGCCCGGTACTTGAGCTGG
TCACCGGCGGCGTGTATATCTGGCTGCCGTTTTCGCAAATACGCTCGCTGGAATCGCCGCAACCGACGCG
CCTGACCGATCTGCTGTGGAAACCCGTTAATATCACCCTGGTGAATGGCGATACGCACGGCGCCTGGCTC
TTTACCCGTTACAGCGGTTCGGAAAGTGCATCCGACGCCCTGCGTCTGTGCCGGGAAACCGCCTGGCAGG
ACGGCCCCGGCGAAACCACCGTGCGAGCGCTGGGGCAGAAAGTGTGGCTGACCAGCCACGGCGATATCAG
CCTGCTGGACATGGCCCATTGTACCTTTCATGCTCAGGAAAACGATGGCGCATGA