SecReT6
Protein ID: 525827702
SecReT6 ID821
T6SS typei3
Gene symbol-
Locus tagCFSAN002069_07800
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069
Repliconchromosome [GenBank: NC_021812] [Browse all T6SS(s) in this replicon]
Location [Strand]794549..795043 [-]
Productcytoplasmic protein
NoteTssE
UniProt IDS5HY36
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.10E-22, Aligned region: 35..147
Protein Sequence: 164 a.a.     [Download]
>gi|525827702|ref|YP_008250395.1| cytoplasmic protein [Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069]
MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIRRDLSFLLNTISHEGDIDARRYPQAA
ASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIRFEPRLNAATLRVTPLLDEARQGSYNTLQFEIRGQIL
TQPYPTEFLVRSALDMELSRITFF
 
Nucleotide Sequence: 495 bp     [Download]
>gi|559996969|ref|NC_021812.2|:c795043-794549 Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069, complete genome
ATGAGCACGTCTCGTTTTACACCCGCTAACCACCTGCTGCCTACGCTGTTTGATCGGCTGTGTGACAATG
CTCCGTATCAGAAAATTGACCGGGATATCAGCGTCACGCCGGTACAACTGAAGGAGATCATTCGTCGGGA
TCTCTCCTTTTTGCTCAATACCATTAGCCACGAGGGTGACATCGACGCCCGGCGCTATCCGCAGGCGGCG
GCGTCAGTGCTCAACTATGGTCTGCCGCCGCTGGCGGGCAGCTTTATGTATGAGCACAAGTGGGACGATA
TCAGCGAGGCGATCCGGCGCGCCATTATCCGTTTCGAACCCCGGCTGAACGCCGCCACACTCAGGGTCAC
GCCCTTGCTCGATGAAGCCCGGCAGGGTAGCTATAACACGCTACAGTTTGAAATTCGCGGACAAATTCTG
ACGCAGCCGTATCCCACGGAGTTTCTGGTACGCAGCGCGCTGGATATGGAGCTGAGCCGCATTACGTTCT
TTTAA