SecReT6
Protein ID: 525839267
SecReT6 ID822
T6SS typei3
Gene symbol-
Locus tagCFSAN001921_15960
StrainSalmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
Repliconchromosome [GenBank: NC_021814] [Browse all T6SS(s) in this replicon]
Location [Strand]3234804..3236993 [-]
Producttype VI secretion protein Vgr
NoteTssI
UniProt IDS5H993
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-79, Aligned region: 121..429
Phage_base_V [PF04717], Evalue: 2.20E-26, Aligned region: 467..559
Phage_base_V [PF04717], Evalue: 2.20E-26, Aligned region: 663..685
Protein Sequence: 729 a.a.     [Download]
>gi|525839267|ref|YP_008256538.1| type VI secretion protein Vgr [Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921]
MSFVSTNNKSGMGGLTTTTPPITGESGGVTADSVAGSVADAAESAVEQAAGSLFGALPEPSGLVKAAVAA
AQAAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGGETLSELFSYVVQLKTPDTLN
LGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWVKLLTHTSDY
KAFQNKTVVDILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTL
VLADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRET
GHATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLM
QTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQEIWTDQYGRVK
VQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWG
LPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHAEKDLNTTVKNNETHTVMVDRTKTIIKNETN
SIGEDRNTTVTKNDGLSVKLAQTINIGTTYRLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLMLHTSDVM
QLIGKGIDMNPDGGTAVTADDIAPLLTSE
 
Nucleotide Sequence: 2190 bp     [Download]
>gi|525836786|ref|NC_021814.1|:c3236993-3234804 Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921, complete genome
ATGAGTTTTGTATCCACAAATAATAAATCCGGTATGGGAGGGCTGACGACAACCACGCCGCCGATAACCG
GAGAAAGTGGCGGTGTCACCGCAGATTCAGTCGCCGGAAGCGTGGCAGATGCGGCGGAATCCGCCGTGGA
ACAGGCTGCGGGATCGCTATTTGGCGCATTGCCGGAGCCATCAGGACTGGTGAAAGCCGCGGTAGCAGCG
GCGCAGGCTGCCGCCGCCGCAGGTATGGCGCAGGATGCGGTATCGGCCATCGTCTCTGCTGTTGCAGGCG
GGCCGGGGGCGCATAATGTGACGGTCAGCGGCAGCGCCGTACCGCCGGGCGCATTACTGTTCGCCAGCCT
GGACGGCGGCGAAACATTAAGTGAACTGTTCAGCTATGTGGTACAGCTAAAAACGCCCGACACCCTGAAT
CTGGGCTATGTCTCCCCGGCGGCCAACCTGCCGCTCAAACCGATGGTGGGCAAAGATCTGTGCGTCAACA
TCGAACTGGATGGTGGCGGTAAACGACATATCAGCGGGCTGGTCACGGCGGCGCGGGTGGTGGGCCATGA
AGGGCGTTCGGTTACCTATGAGCTGCGTATGGAGCCGTGGGTAAAACTGCTGACCCATACCAGCGACTAC
AAAGCATTCCAGAATAAAACCGTGGTGGATATTCTGGATGAGGTTCTGGCGGAATATCCCTACCCGGTGG
AAAAGCGGCTGGTGGAAAGCTACCCGGTACGCACCTGGCAGGTGCAGTACGGTGAAACTGATTTTGATTT
TCTTCAGCGACTGATGCAGGAGTGGGGCATCTACTGGTGGTTTGAGCACAGCGAGGACAGCCACACGCTG
GTGCTGGCGGATGCCATCAGCGCCCACAAAGCATGTCCGGACTCGCCGCTGGTCGAGTGGCACCAGGAAG
GGCTGAAGCTGGACAAGGAGTTTATCCACACTATCACGGCAAACGAGAGCCTGCGGACTGGACAGTGGGT
GCTGGATGATTTCGATTTTACGAAGCCACGTTCATTGCTGGCAAACACAGTGGCAAACCCGCGTGAAACC
GGTCATGCCACCTACGAGCATTATGAGTGGCCGGGAGACTACTTCGACAAGAGTGAAGGCGAGATGCTGA
CGCGCATTCGTATGGAAGCGCAGCGCAGCCCCGGCAGTCGGGTGCTGGGGGGAGGGAATATCCGCACACT
CATGACCGGTTATACCTTCACGCTGGAAAACTATCCCACCGCCGAAGTCAATCAGGAATATCTGCTGATG
CAGACCTTGCTGTTTGTGCAGGACAACGCGCAGCACAGCGGGCAGGACCAGCACTTTACCTTTTCCACCC
GTTTTGAACTGCACCCCACCCGCGAGGTGTTCCGCCCGCAGCGGACGGTGAGCAAACCCCACACCAAAGG
GCCGCAGAGCGCCATCGTCACCGGCCCGGCGGGCCAGGAAATCTGGACGGATCAGTACGGGCGGGTAAAG
GTACAGTTTGGTTGGGATCGCTACGGCAAAATGGATGAAAACAGCTCCTGCTGGATACGCGTCAGCTACC
CGTGGGCGGGCAAAGGCTTCGGGATGATCCAGATCCCGCGTATCGGCCAGGAAGTGCTGGTGGATTTCAA
AAACGGCGATCCGGATCTGCCGATCATCGTGGGGCGTACCTACAACCAGGACACCATGCCGCCGTGGGGA
CTGCCGGGAATGGCGTCGCAGAGCGGGATCTTCAGCCACTCGCTGTATGGCGGGCCAACGAACGGCAACA
TGCTGCGTTTTGACGACAAAACGGGCGCGGAGGAAGTGAAGTTCCACGCGGAAAAAGATCTCAACACCAC
GGTGAAGAATAATGAAACGCATACGGTTATGGTGGATCGCACTAAAACCATTATTAAAAATGAAACCAAC
AGTATTGGTGAGGACAGAAACACCACGGTAACGAAGAATGACGGCCTTTCCGTAAAACTGGCGCAGACGA
TCAATATCGGCACCACTTATCGTTTAGATGTTGGCGATCAATTCACGCTTCGCTGCGGCAATGCGGCGCT
TGTTTTACATAAGGACGGCTCCATTGAGTTTTGTGGCAAGCAACTGATGTTACATACCAGCGATGTCATG
CAACTGATTGGTAAAGGTATTGATATGAACCCGGATGGCGGCACAGCCGTAACCGCCGATGATATTGCCC
CCCTTCTCACCTCTGAGTGA