SecReT6
Protein ID: 525839272
SecReT6 ID822
T6SS typei3
Gene symbol-
Locus tagCFSAN001921_16000
StrainSalmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
Repliconchromosome [GenBank: NC_021814] [Browse all T6SS(s) in this replicon]
Location [Strand]3245752..3247095 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDS5H9A7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.10E-138, Aligned region: 20..445
Protein Sequence: 447 a.a.     [Download]
>gi|525839272|ref|YP_008256546.1| type VI secretion protein [Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921]
MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGFSHYNIDGEALNIGKLILKEASGIFP
DGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPVRAPNSEETTFDNNPESLARFSVHEHDIRDANSLGRG
AQLLQLSHLRLRLLPEKAVTGAWIGLPLTRITGLNPDGRIDIDHDLIPPIINYQASSLMCTWLSWINDLI
RMRADSLAERLTGSDNHGHEAAEVSDYLLLQILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELSTYVRP
QTRRPAEYKEYKHLTPYAGLKSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSDLADFSTLVLA
IKASMPTDVLLQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQIPFQAGYIYYDIRREGALWEHI
ARYGGMAMHTAGEFPGLETELWGVRDK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|525836786|ref|NC_021814.1|:c3247095-3245752 Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921, complete genome
ATGAGCTGGAATGACCGCGTAGTCTGGAGTGAAGGACAATTTTTACTGCCGCAGATGTTTCAGCAGCAAG
AGCGTTATCTGGAACACGTCATGCATTACCGCAGCCTGCCGCTGACCCCCTTTTTCTGGGGATTCAGCCA
CTACAATATTGATGGCGAAGCGCTGAACATCGGTAAACTGATACTGAAAGAGGCATCAGGGATTTTTCCT
GACGGCACGCCGTTTAACGCACCGGACCACACCCCGCTGCCGCCGCCACTGACCATTCTGCCGGAGCACC
TGAACCAGCAGATTTGTCTGGCGGTACCGGTACGCGCGCCGAACAGCGAAGAAACCACGTTTGACAATAA
CCCGGAATCATTGGCGCGTTTCTCGGTACATGAACACGACATCCGCGACGCCAACTCGCTGGGACGTGGC
GCGCAGTTATTACAGCTCAGTCATCTGCGCCTGCGGCTGCTGCCGGAAAAGGCGGTGACGGGCGCCTGGA
TTGGCCTGCCGTTGACCCGCATCACCGGGTTGAACCCTGACGGGCGGATAGATATCGACCACGACCTGAT
CCCGCCCATCATTAATTATCAGGCCAGTTCACTGATGTGTACCTGGCTGTCGTGGATCAACGATCTCATC
CGGATGCGGGCCGATTCGCTGGCGGAACGGCTGACCGGCAGCGACAACCACGGCCATGAAGCAGCGGAGG
TCTCCGATTACCTGCTGCTGCAAATTCTCAATCGCTTTGAGCCGCTGCTGACTCACCTGGCGAAAACCCC
GCTGGCCCCGGAGGTGCTGTACCGCTACCTGTCCGAACTGGCCGGGGAACTCTCCACCTATGTGCGTCCA
CAAACGCGACGGCCCGCTGAATACAAAGAGTACAAACACCTGACGCCCTATGCCGGGTTGAAATCGCTGG
TTGATGAGGTGCAGTTCCTGCTGAACGCGGTACTGATCCGGGGCGCGCAGCGCATCGAGCTGAAAGAGGG
GACTTACGGCATCCTGAATGCGGTGGTGGCCCCTTCCGATCTTGCCGATTTCAGCACGCTGGTACTGGCG
ATAAAGGCTTCAATGCCGACCGATGTGCTACTGCAACATTTTGCCGCCCAGACCAAAATCGGGCCATCCG
ATCGCCTGCCGGAACTGATCCGCTCGCATCTGCCGGGGCTGGCTTTGCAGGTTCTGCCTGTACCACCGCG
CCAAATCCCGTTTCAGGCCGGATACATCTATTACGACATCCGCCGCGAGGGAGCATTGTGGGAACACATT
GCCCGTTACGGCGGGATGGCCATGCATACCGCCGGGGAATTTCCGGGGCTGGAGACAGAACTGTGGGGAG
TGCGCGATAAATGA