SecReT6
Protein ID: 525839275
SecReT6 ID822
T6SS typei3
Gene symbol-
Locus tagCFSAN001921_16015
StrainSalmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
Repliconchromosome [GenBank: NC_021814] [Browse all T6SS(s) in this replicon]
Location [Strand]3248330..3248713 [-]
Producthypothetical protein
NoteSTM0278 (i)
UniProt IDS5H5I0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 127 a.a.     [Download]
>gi|525839275|ref|YP_008256549.1| hypothetical protein CFSAN001921_16015 [Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921]
MDTAVKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYL
EYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
 
Nucleotide Sequence: 384 bp     [Download]
>gi|525836786|ref|NC_021814.1|:c3248713-3248330 Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921, complete genome
GTGGATACTGCCGTGAAATGGTTAATATTAGTTACTTTCAGCATAAGTGGAATGCTGGTATGGCAGCCAT
CCTTTGCACAAGAAGCATTGACCACACAATATTCACAGTCGGAACTCTTAAAAAATTGGGCGCTGAGTCA
TTGTCTGGCATTAGTATACAAAGATGATGTCGTTAAAAACGATGCCAGAGCTACGGCCAGTGCTTACCTT
GAATATGGTAAACAATCTGTGGAGATTTACCATGAAATTGATGAGATTGCGAAAAAATATTCAGGGTTGA
AATATAACGGTTCGATATCATCAGATTTTAATACCATGAAGTGCATAGATTTTATCCATGACAGGGAATT
AAATGAATTAATTAAAAGGCGTGTCGAGAAGTAA