SecReT6
Protein ID: 525839283
SecReT6 ID822
T6SS typei3
Gene symbol-
Locus tagCFSAN001921_16055
StrainSalmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
Repliconchromosome [GenBank: NC_021814] [Browse all T6SS(s) in this replicon]
Location [Strand]3257750..3258244 [+]
Productcytoplasmic protein
NoteTssE
UniProt IDS5H864
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.40E-22, Aligned region: 35..147
Protein Sequence: 164 a.a.     [Download]
>gi|525839283|ref|YP_008256557.1| cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921]
MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIRRDLSFLLNTISHEGDIDARRYPQAA
ASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIRFEPRLNAATLRVTPLLDKTRQGSYNTLQFEIRGQIL
TQPYPTEFLVRSALDMELSRITFF
 
Nucleotide Sequence: 495 bp     [Download]
>gi|525836786|ref|NC_021814.1|:3257750-3258244 Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921, complete genome
ATGAGCACGTCTCGTTTTACACCCGCTAATCACCTGCTGCCCACGCTGTTTGATCGGCTGTGTGACAATG
CTCCGTATCAGAAAATTGACCGGGATATCAGCGTCACGCCGGTACAACTGAAGGAGATCATTCGCCGGGA
TCTCTCCTTTTTGCTCAATACCATTAGCCACGAGGGTGACATCGACGCCCGGCGCTATCCGCAGGCGGCG
GCGTCAGTGCTCAACTATGGCCTGCCGCCGCTGGCGGGCAGCTTTATGTATGAGCATAAGTGGGACGATA
TCAGCGAGGCGATCCGGCGCGCCATTATCCGTTTCGAACCCCGGCTGAACGCCGCCACACTCAGGGTCAC
GCCCTTGCTCGATAAAACCCGGCAGGGTAGCTATAACACGCTACAGTTTGAAATTCGCGGACAAATTCTG
ACGCAGCCGTATCCCACGGAGTTTCTGGTACGCAGCGCGCTGGATATGGAGCTGAGCCGCATTACGTTCT
TTTAA