SecReT6
Protein ID: 525841088
SecReT6 ID822
T6SS typei3
Gene symbol-
Locus tagCFSAN001921_15950
StrainSalmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
Repliconchromosome [GenBank: NC_021814] [Browse all T6SS(s) in this replicon]
Location [Strand]3230221..3234315 [-]
Producttype IV secretion protein Rhs
NotePAAR
UniProt IDS5HDD0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 390..425
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 410..445
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 474..492
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 518..555
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 582..619
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 624..660
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 666..696
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 708..744
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 751..785
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 797..826
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 842..863
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 848..883
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 889..920
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 981..998
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 989..1017
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 1032..1051
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 1056..1089
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 1119..1126
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 1143..1165
PAAR_motif [PF05488], Evalue: 2.60E-15, Aligned region: 71..140
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 549..566
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 576..594
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 866..884
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 1040..1050
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 1145..1177
Protein Sequence: 1364 a.a.     [Download]
>gi|525841088|ref|YP_008256536.1| type IV secretion protein Rhs [Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921]
MYEAARVDDPIYHTSALAGFLIGAIIGIAIIALAAFAFFSCGFLAGLILGFMADQIASGVLQLGEAIGRS
IHHTAGKILTGSENVSTNSRPAARAVLSTVKCDNHIAEKRIAQGSENIYINSQPAARKDDHTECDAVIED
GSPNVFLGGGTQTVLEISSEIPDWLRKVVDVLFVVASLLGGLAGAWRQAAKLGTKFGTKCAAKFIGGELV
GMAVGEAISGLFSNPVDVTTGQKILLPETDFTLPGRLPVTCSRFYASHLETVGLLGRGWRLNWETSLRDD
DEHITLTGVQGRELRYPKTMLTPGHQIFDPEEQLYLSRLHDGRYVLHYTDRSYYVFGDFDSDGMAYLLFM
ETPHRQRIVFGHEGGRLVRIASSSGHHLLLHRTQTPAGERLSRIELVQGGTRGNLVEYRYDDNGQLTGVV
NRAGTQVRQFAYENGLMTAHSNATGFTCRYRWQELDGAPRVTEHDTSDGEHYRFDYDFAAGTTTVTGRQG
ETWQWWYDRETYITAHRTPGGGMYRFTYNEDHFPVNIELPGGRTVAYEYDIQNRVVKTTDPEGRVTQTQW
NGEFDEITRTALDDDAVWKTQYNAHGQPVQETDPEGRVTQYAYDEQGQMCSRTDAAGGTVVTAFDSRGQM
TRYTDCSGRSTGYDHDEDGNLTRVTDAEGKVVRISYNRLGLPETVNSPGKQQDRYTWNALGLMSSHRRIT
GSVESWRYTPRGLLAAHTDEEKRETRWQYTPEGRVAALTNGNGAQYRFSHDADGRLVREVRPDGLSRTFI
LDDSGYLTAIQTTGTQGGVRRETQQRDALGRLLRTENEHGQRTFSYNRLDQITAVTLTPTEAGQQQHRMQ
ADTVRFEYDRSGWLTAEHAGNGSICYQRDALGNPTDITLPDGQHLTHLYYGSGHLLQTALDGLTVSEYER
DSLHRQIMRTQGQLATYSGYDDDGLLSWQRSLASGSAPVLPGQRPARQGCVTSRDYYWNNHGEVGTIDDG
LRGSVVYSYDRSGYLTGRSGQMYDHDRYYYDKAGNLLDNEGQGAVMSNRLPGCGRDRYGYNEWGELTTRR
DQQLEWNAQGQLTRVISGNTETHYGYDALGRRTRKATYGRHTGHTARSRTDFVWEGFRLLQENVQQQGWR
TYLYDAEQPYTPVASVTGRGESRQVWYYHTDVTGTPQEVTAADGTLVWAGYIRGFGENAADISNSGAYFH
QPLRLPGQYFDDETGLHYNLFRYYAPECGRFVSQDPIGLRGGLNLYQYAPNPLKYIDPLGLTATVGRWMG
PAEYQQMLDTGTVVQSSTGTTHVAYPADIDAFGKQAKNGAMYVEFDVPEKSLVPTNEGWAKIVGPDSIEG
RLAKRKGLPVPEMPTAENITVRGEKINGEVEAKC
 
Nucleotide Sequence: 4095 bp     [Download]
>gi|525836786|ref|NC_021814.1|:c3234315-3230221 Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921, complete genome
ATGTATGAAGCAGCCCGTGTGGATGATCCTATCTACCACACCAGCGCGCTCGCCGGGTTTCTTATCGGCG
CTATCATCGGCATCGCCATTATCGCGCTTGCCGCCTTTGCCTTCTTTAGCTGCGGTTTTCTTGCCGGGCT
GATTCTGGGTTTTATGGCCGATCAAATAGCCTCCGGGGTATTGCAACTGGGCGAGGCCATCGGGCGCTCC
ATCCACCACACGGCAGGAAAAATCCTCACCGGTTCGGAGAATGTCAGCACCAACAGTCGCCCGGCGGCGC
GCGCGGTACTGAGTACGGTGAAATGCGATAACCATATCGCAGAAAAACGCATCGCCCAAGGGTCGGAAAA
TATCTACATCAACAGCCAGCCCGCCGCCCGTAAGGATGACCACACCGAATGCGACGCGGTGATTGAAGAC
GGTTCGCCGAATGTGTTTCTCGGCGGCGGCACACAGACGGTACTGGAAATCAGTTCTGAAATTCCGGACT
GGCTGCGCAAGGTGGTGGATGTATTGTTTGTCGTGGCGAGTCTGCTCGGCGGGCTGGCCGGGGCGTGGCG
GCAGGCGGCAAAGCTGGGGACGAAATTTGGCACTAAATGTGCCGCTAAGTTTATCGGCGGGGAGCTTGTC
GGGATGGCCGTGGGTGAGGCTATCAGCGGGCTGTTCAGCAATCCGGTGGATGTGACCACCGGGCAGAAAA
TCCTGCTGCCGGAAACGGACTTCACCCTGCCCGGTCGCCTGCCGGTCACCTGCTCGCGTTTTTACGCCAG
CCACCTGGAAACTGTGGGACTGTTGGGACGGGGCTGGCGGCTGAACTGGGAAACCAGCCTGCGCGATGAC
GATGAACACATCACGCTGACCGGCGTACAGGGGCGGGAACTGCGTTACCCGAAAACGATGCTGACGCCCG
GCCACCAGATATTTGACCCGGAAGAACAGTTATACCTCAGCCGCCTGCATGACGGGCGTTACGTGCTGCA
TTACACCGATCGCAGCTATTACGTATTTGGTGATTTTGACAGTGACGGCATGGCATACCTGCTGTTTATG
GAGACGCCGCACCGCCAGCGCATTGTCTTCGGGCACGAAGGAGGCAGACTGGTACGGATAGCCTCCAGCA
GCGGGCATCACCTGTTACTGCACCGCACACAGACCCCGGCAGGGGAGCGGCTGTCGCGAATTGAACTGGT
GCAGGGCGGCACCCGTGGCAATCTGGTGGAGTACCGGTATGACGATAACGGTCAACTGACCGGCGTGGTG
AACCGGGCGGGAACGCAGGTGCGTCAGTTTGCTTATGAAAACGGGCTGATGACGGCGCACAGCAATGCGA
CGGGGTTCACCTGCCGCTACCGCTGGCAGGAACTCGACGGCGCGCCGCGCGTGACGGAGCACGACACCAG
TGACGGCGAACATTACCGCTTTGACTATGATTTTGCCGCAGGCACCACCACCGTCACCGGCAGGCAGGGG
GAGACATGGCAGTGGTGGTACGACAGGGAAACGTATATCACCGCGCACCGGACGCCGGGCGGTGGAATGT
ACCGCTTCACGTACAACGAAGACCACTTCCCTGTCAACATTGAGCTGCCCGGCGGTCGCACGGTGGCGTA
TGAATATGACATCCAGAACCGGGTGGTGAAGACGACAGATCCGGAAGGCCGGGTGACGCAGACGCAGTGG
AACGGCGAGTTCGACGAAATCACGCGCACGGCGCTGGACGATGACGCTGTCTGGAAAACGCAGTACAACG
CCCACGGCCAGCCAGTGCAGGAGACGGACCCGGAAGGGCGGGTGACGCAGTACGCTTACGATGAACAGGG
GCAGATGTGCAGCCGGACGGATGCGGCGGGCGGCACGGTGGTGACGGCGTTCGACAGCCGGGGGCAGATG
ACGCGGTACACCGACTGTTCAGGGCGCAGCACAGGATATGACCACGATGAGGACGGCAACCTGACGCGGG
TGACGGACGCGGAAGGGAAGGTGGTACGCATCAGCTACAACCGACTTGGGTTGCCGGAGACGGTAAACTC
ACCGGGGAAACAGCAGGACAGGTATACCTGGAATGCGCTGGGGCTGATGAGCAGCCACCGGCGCATCACG
GGGAGCGTGGAGAGCTGGCGGTATACGCCGCGCGGTCTGCTGGCGGCGCACACGGATGAGGAGAAGCGCG
AGACGCGCTGGCAGTACACGCCGGAAGGCCGGGTGGCAGCGCTGACCAACGGCAACGGGGCGCAGTACCG
GTTCAGTCACGATGCGGACGGCAGGCTGGTGCGTGAGGTTCGCCCGGACGGACTGAGCCGTACTTTTATC
CTGGACGACAGCGGTTATCTGACGGCGATACAGACCACGGGCACGCAGGGCGGCGTGCGGCGGGAGACGC
AGCAGCGGGATGCGCTGGGCCGTCTGTTACGGACGGAGAATGAACACGGCCAGCGGACGTTCAGCTACAA
CCGGCTGGACCAGATAACGGCAGTGACGCTCACGCCCACGGAGGCGGGGCAACAGCAGCACCGGATGCAG
GCCGACACGGTGCGTTTTGAGTATGACCGCAGCGGCTGGCTGACGGCGGAGCACGCGGGGAACGGTAGCA
TATGTTATCAGCGCGACGCGCTGGGCAACCCGACGGACATCACGCTGCCGGACGGGCAGCACCTGACGCA
TCTGTATTACGGGAGCGGGCATCTGTTACAGACGGCGCTGGACGGCCTGACGGTGAGCGAGTATGAGCGC
GACAGCCTGCACCGTCAGATAATGCGCACGCAGGGGCAGCTTGCGACGTACAGCGGCTATGACGACGACG
GGCTGCTGAGCTGGCAGCGCAGTCTGGCGTCCGGCAGTGCCCCTGTTCTTCCTGGCCAGCGCCCGGCGCG
GCAGGGCTGCGTGACGTCGAGGGACTATTACTGGAACAACCACGGCGAGGTGGGCACGATTGACGACGGC
CTGCGTGGCAGCGTGGTGTACAGCTATGACAGAAGCGGTTACCTGACCGGGCGCTCAGGTCAGATGTATG
ACCATGACCGTTATTATTACGATAAGGCGGGCAACCTGCTGGATAACGAAGGGCAGGGAGCGGTGATGAG
CAACCGGCTGCCGGGCTGTGGTCGTGACCGTTACGGCTATAACGAGTGGGGCGAGCTGACCACGCGGCGC
GACCAGCAACTGGAGTGGAACGCGCAGGGGCAGCTGACGCGGGTCATCAGCGGCAACACGGAGACGCACT
ACGGCTACGATGCGCTGGGGAGGCGAACCCGCAAGGCGACGTACGGGCGGCACACGGGCCATACGGCGCG
GAGCCGGACGGACTTTGTGTGGGAGGGGTTCAGGCTGTTGCAGGAGAACGTGCAGCAGCAGGGCTGGCGG
ACCTATCTGTACGATGCGGAACAGCCGTACACGCCGGTGGCGAGCGTGACGGGGCGGGGAGAAAGCAGGC
AGGTGTGGTATTACCACACGGATGTGACGGGCACGCCGCAGGAGGTGACGGCGGCGGACGGAACGCTGGT
GTGGGCGGGGTATATCAGGGGGTTTGGAGAGAATGCGGCGGACATCAGCAACAGCGGGGCGTACTTTCAC
CAGCCGCTGCGGCTGCCGGGGCAGTATTTTGACGACGAGACAGGGCTGCATTACAATCTGTTCAGATATT
ATGCACCGGAGTGTGGACGGTTTGTCAGTCAGGATCCGATCGGGCTGAGGGGCGGGTTAAACCTTTATCA
GTATGCGCCAAATCCTCTCAAATATATAGACCCACTTGGTTTAACCGCGACTGTTGGGCGATGGATGGGG
CCTGCGGAATATCAGCAAATGCTTGATACTGGGACAGTAGTACAAAGTTCAACAGGGACAACTCATGTTG
CCTACCCTGCTGATATAGATGCTTTTGGTAAGCAAGCAAAAAATGGTGCTATGTATGTTGAATTTGATGT
GCCTGAAAAATCATTAGTACCTACAAATGAAGGATGGGCAAAAATAGTAGGGCCAGATTCTATCGAAGGG
CGATTAGCTAAACGCAAAGGTTTGCCTGTTCCTGAAATGCCAACAGCAGAAAACATAACTGTAAGGGGCG
AGAAAATTAATGGGGAAGTTGAAGCAAAATGCTAA