SecReT6
Protein ID: 525848285
SecReT6 ID825
T6SS typei5
Gene symbol-
Locus tagM634_23050
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1495922..1497757 [-]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDS5IXW9
KEGG IDvpf:M634_23050
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.00E-57, Aligned region: 30..335
Phage_base_V [PF04717], Evalue: 1.70E-24, Aligned region: 377..470
Protein Sequence: 611 a.a.     [Download]
>gi|525848285|ref|YP_008268924.1| type IV secretion protein Rhs [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MKKASQDNNFIRISSPFGKDALILNSFEYREGISELFSLRAKAYFNDQKHELNEIVGKEVTISVENSSRV
SKSPRFFHGIVSAAKLEGQRVMNSHNGENYKNIEIIVEPKVKFAAYRNNCKIFQKKNIKDIISEVLSEHG
VAFKFELKNTYPQYSYKVQYEESDLAFVQRLLAEEGLSFCFSHSKSSHVLDIFDDVSFYKPSPEFMVDFD
TGSSESSHISAWNETQVLTTKASQKSGFNMLKPASQPKNVAAGDTALFTVPASEYFEYLGETESDDQYSL
RNTHAIESLQQNVYLCSGEASCRTFSVGKCFKFKKHEDKSRVGKEYVLASVTIFASVFNQTGLGGTASQG
VRVAFTCVDSKTILRPAVTYPKPQIKGLQTAIVTGNKDGEVYVDKHGRIKVQFHWDRLGKYDVNSSCWIR
VAQSVAGNGWGAVFHPRVGQEVIVEFVNGDPDQPIVTGALYNGSQLPPYSLPEKSSQSGFKSRSVQKGNA
NFNELRFEDKPGEEHIYLHAEKLFQMLVEDCVDIVVENNKVEKVTNDVTQDVGKNAMLKVGENYTSDTGK
VLSLNAGKSIEIKVGEASIQMSSSGEINIKGNKISINGSVIALKAGQISLN
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1497757-1495922 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
ATGAAAAAAGCAAGTCAAGACAACAACTTTATCCGTATTTCTTCTCCGTTTGGAAAAGATGCTCTTATTC
TCAATTCGTTCGAATATAGAGAAGGGATCTCGGAGCTTTTTTCATTGCGTGCTAAAGCTTATTTTAATGA
TCAAAAACATGAGCTCAATGAAATCGTGGGTAAAGAAGTAACGATTTCAGTGGAAAATAGTAGTCGTGTT
TCTAAAAGTCCGCGTTTTTTCCATGGCATTGTCTCTGCTGCAAAGCTCGAAGGCCAGAGAGTGATGAATT
CTCATAATGGAGAAAACTACAAAAATATTGAAATTATTGTTGAACCGAAAGTTAAGTTCGCAGCGTACAG
AAATAATTGTAAGATCTTTCAGAAGAAAAATATAAAAGACATTATTTCCGAAGTGCTTTCAGAGCATGGT
GTTGCATTTAAATTTGAACTAAAAAATACGTATCCCCAATATTCCTACAAAGTTCAGTATGAAGAATCTG
ATCTTGCTTTTGTTCAGCGCCTCCTAGCCGAAGAAGGGCTCTCTTTTTGCTTTAGTCACTCTAAATCATC
CCATGTCCTAGATATTTTTGATGATGTAAGCTTTTACAAACCCAGTCCTGAGTTTATGGTCGATTTCGAT
ACAGGTAGTTCAGAGTCGAGTCACATTTCTGCTTGGAACGAAACACAAGTTTTAACGACTAAAGCAAGCC
AGAAGTCTGGCTTCAATATGCTTAAACCAGCCTCACAACCCAAAAACGTAGCTGCTGGTGATACTGCACT
GTTTACCGTACCTGCGAGTGAGTATTTTGAGTATCTGGGTGAAACAGAAAGTGACGATCAGTACTCGCTT
CGAAACACTCACGCAATTGAATCCCTTCAACAGAACGTTTATCTATGTAGCGGAGAGGCGAGTTGTCGAA
CCTTTTCTGTGGGTAAATGTTTTAAGTTCAAAAAACACGAAGATAAATCGCGAGTAGGAAAAGAATATGT
CTTGGCCTCTGTGACGATTTTTGCTTCTGTGTTTAATCAAACTGGTCTGGGTGGCACCGCTTCTCAAGGT
GTTCGTGTTGCGTTTACTTGTGTGGACTCTAAAACCATTTTAAGGCCGGCGGTTACTTACCCTAAACCGC
AAATTAAAGGTCTTCAAACAGCCATTGTGACTGGTAATAAAGACGGTGAGGTATACGTTGATAAACATGG
CAGAATAAAAGTACAGTTCCATTGGGATCGTTTGGGTAAGTACGATGTAAATAGTTCGTGTTGGATTCGA
GTTGCTCAAAGTGTTGCCGGAAATGGATGGGGTGCGGTGTTTCATCCTCGGGTAGGGCAAGAGGTTATCG
TAGAGTTTGTGAATGGCGACCCAGATCAACCTATTGTCACGGGTGCGCTGTATAACGGGAGCCAGTTGCC
CCCGTATTCTCTTCCAGAGAAAAGTTCTCAAAGCGGTTTTAAGTCCCGCTCAGTTCAAAAAGGAAACGCC
AATTTCAACGAGTTACGCTTTGAAGATAAACCTGGCGAAGAACACATTTACCTTCACGCAGAAAAGTTGT
TCCAAATGTTAGTCGAAGACTGCGTAGATATTGTGGTTGAGAACAATAAAGTTGAGAAAGTAACCAACGA
TGTCACTCAAGACGTTGGAAAAAATGCGATGTTAAAAGTGGGAGAGAACTATACCTCTGACACTGGAAAA
GTGTTGTCCCTCAATGCAGGGAAAAGTATTGAAATTAAAGTCGGTGAAGCCTCAATTCAAATGTCGAGTT
CTGGCGAAATCAACATTAAGGGCAACAAGATTTCTATCAATGGCTCTGTAATCGCATTGAAAGCAGGACA
AATCTCTTTGAATTAA