SecReT6
Protein ID: 525848288
SecReT6 ID825
T6SS typei5
Gene symbol-
Locus tagM634_23065
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1501078..1502043 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDS5ITY8
KEGG IDvpf:M634_23065
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.70E-76, Aligned region: 8..307
Protein Sequence: 321 a.a.     [Download]
>gi|525848288|ref|YP_008268927.1| type VI secretion protein [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MSSEDFYRELKQRSLFEAIHLIEQELLKVESQIGTDALPKNEKLNLKVNASLGFENAQLVSTKPLGKDKL
ALETNLIGLTGEQGVLPQHYSELALHRLKEGDHAMVDFYDIFNHRLLSLYYRSWQLSQLTIQARAHAKNQ
RSPLIDCMSSLTGDGNDLALHYGGMYASPTRSKGALKSILECLSGCQIRIHEFQGQWMRLSKSEQTRLAS
KSMPEGQFAQLGAGASLGKRAWNINASTTIEFLPKERKQVKNLLPKTNTLKTIKQVAGDFIGKHKHVKWQ
LTTKHSLLPQVQISKQQGQLGVGSVLKKHERTEDRNITITV
 
Nucleotide Sequence: 966 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1502043-1501078 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
ATGAGCTCAGAGGACTTCTACCGCGAGCTAAAGCAACGTTCTTTGTTTGAAGCTATTCATCTTATTGAGC
AAGAGCTTTTGAAAGTTGAATCGCAAATTGGAACAGATGCATTACCCAAAAACGAGAAACTCAACTTAAA
GGTCAATGCATCTTTAGGCTTTGAGAATGCGCAACTCGTTTCTACTAAACCATTAGGTAAAGATAAATTA
GCGCTTGAGACAAATTTGATTGGCTTGACGGGGGAGCAGGGTGTACTGCCTCAGCATTACAGTGAGCTTG
CATTGCATCGACTGAAAGAAGGCGATCATGCGATGGTGGACTTCTATGACATTTTTAACCATCGGCTTTT
ATCCCTCTATTATCGAAGTTGGCAATTGAGTCAGCTAACCATACAAGCGCGTGCGCATGCAAAAAATCAG
CGCTCCCCATTAATTGATTGCATGTCGTCATTGACTGGCGATGGGAATGATCTTGCACTGCATTATGGCG
GCATGTATGCATCTCCAACACGAAGTAAAGGTGCATTGAAGAGCATTTTGGAATGTTTGTCTGGTTGCCA
AATTCGTATTCACGAGTTTCAAGGTCAATGGATGCGACTGTCTAAATCTGAACAAACTCGTTTGGCATCG
AAAAGTATGCCCGAAGGCCAGTTTGCACAACTCGGTGCTGGTGCGTCACTAGGAAAAAGAGCCTGGAATA
TCAATGCAAGTACAACAATTGAGTTTCTCCCAAAGGAAAGAAAGCAAGTCAAAAATCTGTTACCCAAGAC
CAATACATTGAAAACGATAAAACAGGTAGCAGGTGACTTCATTGGCAAACACAAGCACGTTAAATGGCAA
CTCACGACTAAACATAGTCTATTGCCTCAAGTTCAAATATCTAAGCAACAAGGTCAGTTAGGTGTCGGCT
CTGTACTGAAAAAACATGAACGTACGGAAGATCGCAACATAACAATTACGGTTTAA