SecReT6
Protein ID: 525848289
SecReT6 ID825
T6SS typei5
Gene symbol-
Locus tagM634_23070
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1502040..1503863 [-]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDS5JDR4
KEGG IDvpf:M634_23070
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.00E-191, Aligned region: 5..607
Protein Sequence: 607 a.a.     [Download]
>gi|525848289|ref|YP_008268928.1| type VI secretion system protein ImpG [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MSEEFLKYYNRELAYLRHKGQEFGEQYPKIAARLRISEEQVEDPHVERLLEGCAFLTARIRQSLDNSYPQ
FTESLMGQLYPDFHAPIPSMSVIKLNCSESTTSSFAIPVGERVEVSAPGYQDCQFRTGYPTTMYPLDIIS
GSFENAPFKPTGSKWEHNAHSVLRCQLSAHDSESSINSMGIDCLRLYLNGQTQLTLKLYQMLFQSLIGLS
IVLDGKEIMPLTKRHLQSVGFGDEEQVVPYSKRSFSGSRLLVEYLHFPEKFMFFDLIELGLDKLEIQGQV
EICFYFDTSNDWLPKQVDEESVMVGCVPIVNLFKSTMEPKRLLPTEYEYQLSPQYQDAESNEVVSISDVT
LRNWNKTYEHLPCYHSGEHKHYMSASEVYWLMRREDKNWAGGYDEPGRETYVSFVDKQYQLFSPESRDNW
LMYVEAECCNRNLPQKIPFGGGLPKVQLPNVDDNFKSIRCLTSLSETLRPEMDESTRWQLTKLLTLNHFT
EADGLATLKQTLNLYAFAGTAETKAVIDALVKLEFEHTTGRVSQKGKVGFAHGVKLVLTVSDQILPKEQI
FLLGSVLSVYFAQYAEINVFTQLEIKLKSTSSSFHVWPALTGDKVLL
 
Nucleotide Sequence: 1824 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1503863-1502040 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
ATGAGTGAAGAGTTTCTAAAATACTACAATCGTGAATTGGCCTATCTGCGACACAAAGGACAAGAGTTTG
GCGAGCAATATCCTAAAATTGCGGCTAGGTTACGTATCAGCGAAGAACAAGTTGAAGACCCACATGTTGA
ACGTCTGTTGGAAGGTTGTGCTTTTTTAACCGCTCGGATAAGACAAAGTCTGGATAACAGTTACCCACAG
TTTACGGAATCACTTATGGGACAGCTATATCCGGACTTTCATGCGCCAATTCCTTCGATGTCCGTGATCA
AATTGAACTGTTCAGAGTCAACCACTAGTTCATTTGCTATTCCTGTGGGTGAAAGAGTCGAAGTTAGTGC
CCCTGGATATCAAGATTGCCAGTTTCGAACCGGTTACCCGACAACAATGTATCCACTCGATATTATCTCT
GGTTCATTTGAGAACGCGCCTTTCAAGCCTACTGGCTCTAAGTGGGAGCACAATGCGCACTCTGTACTAA
GGTGTCAGCTGAGTGCTCATGATTCAGAGTCCTCTATCAATTCCATGGGTATCGATTGTTTGCGTTTGTA
CTTAAATGGACAGACGCAATTAACACTCAAGCTATATCAAATGTTATTCCAAAGTTTGATTGGTCTTTCA
ATCGTATTGGATGGTAAAGAAATCATGCCTCTAACTAAGAGGCATCTTCAATCGGTTGGTTTTGGGGACG
AGGAGCAAGTCGTCCCTTACAGTAAGAGAAGTTTTTCGGGATCTCGTTTATTGGTCGAGTACCTTCATTT
CCCAGAAAAATTCATGTTCTTTGACTTGATTGAGCTCGGCTTAGATAAGTTAGAGATTCAAGGGCAGGTC
GAGATTTGCTTTTACTTCGATACAAGCAATGACTGGCTACCAAAGCAAGTCGACGAGGAAAGTGTCATGG
TTGGCTGTGTTCCCATTGTAAATCTGTTCAAATCAACCATGGAACCTAAACGTCTCCTTCCAACAGAGTA
CGAGTATCAATTATCTCCTCAGTACCAAGATGCAGAGAGTAATGAAGTTGTCTCGATTTCTGATGTGACC
TTGAGAAACTGGAACAAAACTTACGAGCACTTACCCTGCTACCATTCAGGAGAGCACAAGCACTACATGA
GCGCGAGTGAAGTGTATTGGTTAATGAGACGAGAGGATAAAAACTGGGCCGGTGGCTACGATGAGCCTGG
TCGAGAGACTTATGTTTCTTTTGTTGATAAGCAATACCAGTTGTTCAGCCCTGAAAGCAGAGATAATTGG
CTGATGTATGTGGAAGCTGAGTGTTGCAATCGTAATTTGCCACAAAAAATTCCATTTGGTGGCGGGCTAC
CAAAGGTTCAGTTACCCAATGTTGATGATAACTTTAAATCAATCAGGTGCTTAACGTCTCTCTCCGAAAC
GCTTAGACCAGAGATGGATGAAAGCACACGATGGCAGCTTACCAAGCTATTAACATTGAACCATTTTACT
GAAGCTGACGGCTTAGCAACGTTAAAGCAAACATTGAACTTGTATGCATTTGCAGGCACTGCCGAAACAA
AAGCCGTTATAGATGCTCTAGTCAAGCTAGAGTTTGAACATACAACCGGTAGGGTTAGTCAGAAAGGAAA
AGTTGGTTTTGCACATGGAGTAAAGCTGGTTCTAACAGTATCCGATCAGATACTGCCAAAAGAGCAGATC
TTTTTATTGGGTAGCGTGTTATCTGTTTACTTTGCTCAATATGCGGAGATTAACGTGTTTACGCAGTTAG
AGATTAAGTTGAAATCAACCAGCAGCTCCTTTCACGTATGGCCTGCGCTGACAGGTGATAAGGTGTTGTT
ATGA