SecReT6
Protein ID: 525848290
SecReT6 ID825
T6SS typei5
Gene symbol-
Locus tagM634_23075
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1503860..1504324 [-]
Productlysozyme
NoteTssE
UniProt IDS5IXX4
KEGG IDvpf:M634_23075
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.90E-20, Aligned region: 27..129
Protein Sequence: 154 a.a.     [Download]
>gi|525848290|ref|YP_008268929.1| lysozyme [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MALTVSLLDKLIDSDPTTREEKDFPVSQQHMLNGLLRDLESMLNSRIGWKNIHEDFLEVRYSILNYGLPD
FSSMPYSSQDGQSQLCDIVYEAIREFEPRLRNPHVQISDEKNAIDRTLRLEISATCLIDNDIHELKFNSE
VEPVNLGMKLSRAK
 
Nucleotide Sequence: 465 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1504324-1503860 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
ATGGCTTTAACGGTTTCACTGCTAGACAAGTTGATTGATAGCGACCCAACTACCAGAGAAGAAAAAGATT
TTCCTGTGAGTCAGCAACACATGCTCAATGGTTTGTTAAGAGACTTAGAGTCGATGCTTAATAGTCGTAT
TGGTTGGAAAAATATTCACGAAGACTTTTTAGAAGTTAGATACTCAATCCTTAACTATGGGTTACCTGAT
TTTTCTTCAATGCCTTATAGCAGCCAAGATGGACAAAGTCAGTTGTGTGACATCGTTTATGAAGCTATTC
GGGAGTTTGAACCTCGGTTAAGAAATCCGCACGTTCAAATTTCTGATGAAAAAAATGCGATAGATCGGAC
CTTACGGTTAGAAATTAGCGCAACTTGTTTGATTGATAATGATATCCACGAGTTGAAATTCAATTCGGAA
GTCGAGCCAGTGAACTTAGGAATGAAGTTGAGTCGAGCGAAATGA