SecReT6
Protein ID: 525848291
SecReT6 ID825
T6SS typei5
Gene symbol-
Locus tagM634_23080
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1504333..1505130 [-]
Productprotein of avirulence locus ImpE
NoteTagJ
UniProt IDS5J048
KEGG IDvpf:M634_23080
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.30E-39, Aligned region: 138..259
TPR_19 [PF14559], Evalue: 0.0016, Aligned region: 7..63
TPR_11 [PF13414], Evalue: 0.0042, Aligned region: 7..62
Protein Sequence: 265 a.a.     [Download]
>gi|525848291|ref|YP_008268930.1| protein of avirulence locus ImpE [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MTQWKNALSEGLLQQALELLIEAIKASPKDASLRSSFIELLCIDGDFERADEQLMQSIKLFPEYLPGASQ
LRHLVKAAQARKDFAQGAATAKVLGENEELTKSLVSFNLSMVSQDYEQVSELALQIEELRQEKGFLANDT
SFSDVRDIDDRLGGYIELFSTAGNYFLVPIASINTLEIKSATSLLESVWRPVEFDIDGLGEGEGHMPMTY
VDSESDAQKLGRETDWKQIADEEVYLGLGLKCWLVGEIALPISDLQNLQVIKELA
 
Nucleotide Sequence: 798 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1505130-1504333 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
ATGACTCAGTGGAAAAATGCCTTATCTGAAGGGCTGTTGCAACAAGCTTTAGAATTACTAATCGAAGCGA
TAAAGGCATCTCCAAAGGATGCCAGTTTGAGAAGCTCTTTTATTGAACTGCTTTGTATTGATGGTGATTT
TGAGCGAGCTGATGAGCAACTGATGCAGTCTATTAAACTGTTTCCTGAATATCTTCCAGGCGCTAGCCAG
TTAAGACATCTGGTTAAAGCTGCTCAAGCGCGAAAGGATTTCGCTCAAGGTGCGGCAACCGCGAAGGTAT
TGGGTGAGAACGAAGAACTAACTAAGTCATTGGTTAGCTTCAACTTATCAATGGTGAGTCAAGATTATGA
ACAAGTTTCTGAACTTGCTCTTCAAATCGAAGAACTGAGACAAGAAAAAGGCTTTTTAGCTAATGATACT
TCGTTCTCAGACGTGCGGGATATTGATGATCGTTTAGGTGGTTACATTGAGCTGTTTTCTACCGCAGGCA
ACTACTTTCTCGTCCCTATTGCTAGCATCAACACTTTAGAAATCAAATCTGCTACCTCTTTGCTAGAAAG
TGTTTGGCGCCCCGTTGAGTTTGACATTGACGGTTTAGGTGAAGGTGAAGGCCATATGCCGATGACTTAC
GTGGATTCAGAAAGTGATGCTCAGAAACTAGGTCGTGAAACGGACTGGAAACAAATAGCAGACGAAGAAG
TTTACTTAGGTTTAGGTCTGAAGTGTTGGCTTGTCGGTGAAATAGCGCTGCCGATTTCTGACTTACAAAA
TCTACAAGTAATAAAAGAGTTGGCGTAA