SecReT6
Protein ID: 525848292
SecReT6 ID825
T6SS typei5
Gene symbol-
Locus tagM634_23085
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1505141..1506661 [-]
Producttype VI secretion protein
NoteTssC
UniProt IDS5J995
KEGG IDvpf:M634_23085
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.90E-163, Aligned region: 69..500
Protein Sequence: 506 a.a.     [Download]
>gi|525848292|ref|YP_008268931.1| type VI secretion protein [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MVVMTKIDALNFLDPEELTHEFTPMGLAEFDSHWLTKFVECSDSILAARIWLEGTQSKDFASFRHSIVST
INTIDTLLQKQLNEVIHHPDFQKLEGSWVGVRYLCEQVDKPSSDSVKIKVLSATWNEVSKDALKAIEFDQ
SALFKLLYQNEYGMAGGEPFGVVVGDYQLRYDPRTNYFDRDISVLSKISQSAAAAFSPFVMSASPEIFGV
NTFAELSSTRDVAAQFEQIDYVKWRQLRDNDDTKFIGLTAPNVLFRQPYKSDGSRNDQFEFQENIDDSNN
DLLWGSGAFCFAAVSIRAFQEHGWFTHMRGIKQGDYSQGIIVAPTRNKTRINGKNDRDRCPLNLKVSERK
EQELSDCGFIPISPVPETDMVGMTSNVSLYKPKLYEEKHVATNAKLTSMLQYTMCVSRIAHYVKVMGRDK
IGGYQDAASLEREFQTWLHQYTTASDEASDELRAKYPLNEAKIKVREKRDTPGHFYSVIHLRPHFQLDQM
VSSIKLITELSPEHLV
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1506661-1505141 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
ATGGTAGTTATGACGAAAATAGATGCATTGAACTTTCTAGACCCAGAGGAACTCACGCACGAGTTTACAC
CGATGGGCCTGGCTGAGTTTGACAGTCATTGGTTGACTAAATTTGTTGAATGTTCAGATTCAATACTTGC
GGCACGAATTTGGTTGGAAGGCACGCAATCTAAAGATTTTGCGAGTTTTCGCCATAGCATTGTGAGCACG
ATTAATACCATTGACACACTATTACAGAAGCAGCTCAATGAGGTCATTCATCATCCAGATTTTCAGAAAT
TAGAGGGCAGTTGGGTAGGCGTTCGATATTTATGTGAACAAGTTGATAAACCATCGTCTGACTCCGTAAA
AATTAAAGTTCTATCTGCAACATGGAATGAAGTAAGTAAAGATGCGCTCAAGGCTATCGAGTTCGATCAG
TCTGCCTTGTTTAAATTGCTCTATCAAAATGAATATGGAATGGCCGGAGGAGAACCCTTTGGTGTGGTTG
TTGGTGATTATCAATTACGTTATGACCCGAGAACAAATTATTTTGATAGAGATATCTCTGTGCTAAGCAA
GATATCTCAGTCTGCTGCTGCGGCATTTAGTCCATTTGTAATGTCTGCGTCTCCTGAAATATTCGGTGTG
AACACATTTGCCGAACTTTCGTCGACTCGAGACGTTGCGGCACAATTTGAACAAATTGATTATGTCAAAT
GGAGACAGTTGCGAGATAACGATGATACCAAGTTTATTGGCTTAACCGCTCCTAACGTGCTTTTTCGACA
ACCCTATAAAAGTGATGGTTCTCGAAACGATCAATTTGAATTTCAAGAGAATATTGACGATTCAAATAAC
GATTTATTGTGGGGAAGTGGAGCCTTCTGTTTTGCTGCTGTTTCGATTAGAGCATTCCAAGAGCACGGTT
GGTTTACTCACATGCGAGGAATAAAACAGGGGGATTATAGTCAAGGCATTATTGTTGCTCCTACAAGAAA
CAAAACGCGCATTAATGGCAAAAATGACAGAGATAGATGCCCTTTAAATCTAAAAGTCTCTGAGCGTAAA
GAGCAAGAACTGTCTGATTGTGGGTTCATTCCGATTTCACCAGTTCCTGAAACAGACATGGTCGGCATGA
CTTCCAATGTTTCGTTGTATAAGCCAAAACTGTACGAAGAGAAGCATGTTGCGACTAATGCAAAACTCAC
CTCAATGCTCCAATACACGATGTGTGTATCGCGTATAGCACACTACGTCAAAGTTATGGGGCGAGACAAG
ATAGGTGGCTATCAGGACGCGGCATCGCTCGAGAGGGAGTTTCAGACTTGGTTACATCAATATACAACGG
CTTCAGACGAAGCTTCGGATGAACTCAGAGCTAAGTACCCATTGAACGAAGCGAAGATCAAAGTTAGAGA
GAAACGCGATACGCCAGGGCACTTCTACTCGGTGATACATTTACGCCCTCATTTCCAGCTCGACCAAATG
GTCTCAAGTATCAAATTAATTACGGAATTATCACCAGAACATTTGGTGTAA