SecReT6
Protein ID: 525848293
SecReT6 ID825
T6SS typei5
Gene symbol-
Locus tagM634_23090
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1506708..1508201 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDS5ITZ3
KEGG IDvpf:M634_23090
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.30E-184, Aligned region: 63..493
Protein Sequence: 497 a.a.     [Download]
>gi|525848293|ref|YP_008268932.1| EvpB family type VI secretion protein [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MTTQVEKQLDPTVGEQTTSFLEQAIGATKQTEASRAEELIKTLTEEAMKGTVSWNKNLTVTFREAINLLD
RQISEQLSEVMHHPELQKLEGSWRGLNYLVMNSETSSTLKIRMISITKKELHKDLSKAVEFDQSQIFKKV
YESEFGSAGGEPYGALIGDYEFTNHPEDIESLRLMSNVAASGFSPFLSAASPALFGFDEWTELSKPRDLD
KVFESLEYAQWRSFRESADSRFVSLTMPKVLARLPYGQATSPVEAFGFEEFDVDPVSGIAVNADHNDYCW
MNSSYVLGVKLTDAFSKYGFCTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITDRREAELGKLG
FLPLCHYKNTNYAVFFGAQTCQKPANHESPEVAANAAISARLPYMMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVKEIPGSPGSYNAVAWLKPWLQMEELTTSLRLVA
KIPQSGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1508201-1506708 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
ATGACGACTCAAGTTGAAAAACAACTCGATCCTACGGTGGGTGAACAAACCACTTCATTTCTTGAACAGG
CTATTGGTGCGACGAAACAAACAGAAGCATCGAGAGCAGAAGAGCTGATCAAGACACTGACTGAAGAAGC
GATGAAGGGGACGGTTTCTTGGAATAAAAACCTAACCGTAACTTTCCGTGAAGCGATTAATTTGCTTGAT
AGACAGATTTCAGAGCAGCTTTCTGAAGTTATGCACCATCCTGAGCTACAAAAGTTAGAAGGCTCATGGC
GTGGGCTGAATTACTTAGTCATGAATTCTGAGACAAGTTCTACGCTGAAAATTCGCATGATTAGCATCAC
GAAGAAAGAGCTTCATAAAGACTTAAGTAAAGCGGTTGAATTCGATCAAAGTCAAATCTTTAAAAAAGTG
TACGAATCTGAATTTGGTAGCGCTGGTGGTGAACCGTATGGTGCTTTAATTGGTGACTACGAGTTTACAA
ACCATCCAGAAGATATTGAGTCTTTGCGTTTAATGTCGAATGTTGCTGCTTCGGGTTTCTCACCATTCTT
GTCTGCTGCTTCTCCTGCGCTATTTGGTTTTGATGAGTGGACAGAACTATCTAAACCGCGTGATTTAGAT
AAAGTCTTTGAGTCGTTGGAATATGCGCAATGGCGCTCTTTCCGTGAAAGTGCAGATTCTCGTTTTGTAA
GCTTAACGATGCCTAAAGTATTAGCTCGCTTGCCATACGGCCAAGCTACCTCTCCTGTAGAAGCGTTTGG
CTTTGAAGAGTTTGATGTGGATCCTGTGTCGGGTATCGCCGTTAATGCTGATCACAATGATTATTGTTGG
ATGAATTCATCGTACGTGCTTGGCGTCAAACTGACGGATGCATTTTCTAAGTATGGTTTCTGTACTGCTA
TTCGTGGCGCAGAGGGTGGTGGGCGAGTTGATAACCTACCAACACACTTCTTCATGAGTGATGATGGTGA
CCCAGATATGAAGTGCCCAACGGAAATTGGCATTACAGACCGCCGTGAAGCGGAATTGGGTAAACTGGGT
TTCTTACCGTTGTGTCACTACAAAAATACAAACTATGCCGTGTTCTTTGGTGCTCAAACTTGTCAAAAAC
CAGCAAATCATGAATCTCCAGAAGTGGCAGCAAACGCGGCAATTTCAGCAAGACTTCCTTACATGATGGC
AACCTCTCGTTTTGCACATTATTTGAAAGTAATGGCTCGAGACAAGATCGGTAGCTTTATGGAAGCAGAA
GACGTTGAATCTTGGTTGAACCGTTGGATTCTTGGCTATGTGAACGCTTCTGAAGGTGGCGGTCAAGAAA
TTCGTGCGAAATACCCTCTTGCCGACGCTCGCGTACAAGTTAAGGAGATTCCAGGTTCTCCTGGTTCTTA
CAACGCGGTTGCTTGGCTCAAACCATGGCTTCAAATGGAAGAGCTAACCACGTCTTTAAGACTCGTTGCT
AAAATTCCTCAGTCGGGTGGCTAA