SecReT6
Protein ID: 525848294
SecReT6 ID825
T6SS typei5
Gene symbol-
Locus tagM634_23095
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1508201..1508731 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDS5JDR9
KEGG IDvpf:M634_23095
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.50E-62, Aligned region: 8..162
Protein Sequence: 176 a.a.     [Download]
>gi|525848294|ref|YP_008268933.1| type VI secretion protein [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MTSIHSKLSRVRKPRVHITYDVETEGTTLKKELPFVVGVMGDFAGQNTEALKPLKDRRFIQIDRDNFDDV
LKKMSPSVKFKVANKLANDDSEFAVELSFKSMQDFEPAAIVNQVEPLRQLMETRNKLRDLMTKVDRSEEL
ENILEEVLNNTDNLAKLAGELDLGKKAPSESTEGAE
 
Nucleotide Sequence: 531 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1508731-1508201 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
ATGACGAGTATCCACTCGAAACTTTCACGAGTACGGAAGCCTCGTGTTCACATTACCTACGATGTTGAAA
CCGAAGGAACAACTTTGAAAAAAGAGCTTCCTTTTGTGGTGGGTGTTATGGGCGACTTTGCAGGCCAAAA
TACCGAAGCATTGAAACCATTAAAGGATCGCCGTTTCATTCAAATCGATCGTGATAACTTCGATGATGTA
CTTAAAAAGATGAGTCCATCGGTTAAGTTCAAAGTCGCAAACAAGTTAGCAAATGACGATTCTGAATTTG
CGGTTGAACTGAGCTTTAAATCGATGCAAGACTTTGAACCAGCAGCGATTGTCAATCAAGTAGAACCATT
GCGTCAGCTGATGGAAACTCGTAACAAACTGCGAGACTTGATGACTAAAGTCGACCGTTCGGAAGAACTT
GAAAACATCCTAGAAGAAGTTCTCAACAATACAGACAATTTGGCAAAACTAGCTGGTGAGCTAGATCTTG
GCAAAAAAGCGCCATCAGAAAGTACTGAGGGAGCAGAATAA