SecReT6
Protein ID: 525848295
SecReT6 ID825
T6SS typei5
Gene symbol-
Locus tagM634_23100
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1508747..1509868 [-]
Producttype VI secretion protein
NoteTssA
UniProt IDS5IXX8
KEGG IDvpf:M634_23100
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.90E-20, Aligned region: 67..127
Protein Sequence: 373 a.a.     [Download]
>gi|525848295|ref|YP_008268934.1| type VI secretion protein [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MSNTMFDWYEQVLAPISEYNPTGIDPREDVSPQSAYYRLKDQRMVARNAERNAIIEEESIHTHNNLWRVF
VEEVPEVLATQSKDFEFVAWLIEALTRLYGFRGMGVGYKIASAFVESYWDELHPMPDEDGIETRISAITG
LNGIDSEGTLIFPLASIPLTDMGAEQAYAYWEYQQAIELERLDEDKRRARVDQGAIELSRITDTVKSTSD
EFYQSLIADLEFATGAFNEFSQRLDDAVGDVTPSSYISKRIESIHAALKHLLGNRFKDKAEVSISDENGD
EELEEASQQAVTHNSSALLVTNMQSREQAIQQLQHVADFFRESEPHSPVSYSIEQIIRWCGMPLPELLAE
LISDGDAKRSYFRLVGIAEQNEN
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1509868-1508747 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
ATGAGTAACACGATGTTTGATTGGTATGAGCAAGTCCTTGCACCAATTTCGGAATACAATCCGACTGGCA
TTGATCCAAGAGAGGATGTCTCTCCTCAGTCTGCTTATTATCGACTTAAAGATCAGCGAATGGTGGCAAG
AAACGCAGAGCGAAACGCCATCATCGAAGAAGAGAGTATTCATACACATAACAACTTATGGCGCGTTTTT
GTTGAAGAAGTACCAGAAGTTCTCGCTACACAATCAAAAGATTTTGAGTTTGTTGCCTGGCTAATAGAAG
CATTAACTCGGCTTTATGGTTTTAGAGGCATGGGCGTAGGCTACAAAATTGCTAGCGCGTTTGTTGAGTC
ATATTGGGATGAGCTGCACCCAATGCCTGATGAAGACGGCATAGAAACGCGGATTTCTGCCATCACCGGA
CTTAATGGTATTGATAGTGAGGGAACGCTGATCTTTCCTCTTGCCTCGATTCCATTGACGGATATGGGTG
CAGAGCAAGCTTATGCATATTGGGAATACCAACAAGCTATTGAACTCGAGCGCTTGGACGAAGACAAGCG
AAGAGCACGAGTAGATCAAGGCGCAATTGAATTGTCGCGTATCACTGACACGGTGAAATCAACTTCTGAT
GAGTTTTACCAGTCTCTGATTGCAGATCTCGAGTTCGCTACAGGTGCTTTTAATGAGTTCAGTCAGCGAC
TTGATGACGCTGTAGGGGATGTAACGCCTAGCTCATATATTTCAAAAAGAATTGAATCAATACACGCGGC
ACTTAAGCACTTGTTGGGTAATCGTTTTAAGGATAAGGCTGAGGTCTCCATTTCTGACGAAAATGGTGAT
GAAGAGTTAGAAGAAGCAAGTCAACAAGCAGTTACTCACAACTCATCTGCGTTATTAGTTACAAACATGC
AATCTCGAGAACAAGCTATTCAACAGTTGCAACATGTGGCGGACTTTTTTAGAGAAAGCGAGCCTCACTC
ACCAGTTTCTTACTCCATCGAACAAATTATTCGTTGGTGTGGAATGCCTCTGCCTGAATTACTGGCGGAA
CTAATCTCCGACGGAGACGCAAAACGAAGCTACTTCCGTTTGGTTGGCATAGCAGAACAAAATGAAAATT
AA