SecReT6
Protein ID: 525848299
SecReT6 ID825
T6SS typei5
Gene symbol-
Locus tagM634_23125
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1516179..1517504 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDS5JDS6
KEGG IDvpf:M634_23125
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.90E-130, Aligned region: 19..439
Protein Sequence: 441 a.a.     [Download]
>gi|525848299|ref|YP_008268939.1| type VI secretion protein [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MMQYSKTAWCEGMFLRPQHFQQHERAISNEYKGLHSLGGSYNWGVWNCRVKEHALKTGLIELDNLQAILP
DMTLIDFSATTSFLSPLKVKKGTENTLVKVIVPLSKVSSKMIADPSETTVSRYLLQDLDVIDNLTGQDEE
TIQVASLNIELKSSNEQLTGYIELPILKIKEVSTEGEVILDDSYVPPLLNLLNDKVMTGYLRNAMAMTKI
RADVIAQRLVKGKAASASAVDFIMLQMLNRYEAILKHFSELEKVHPLELATTFKGYIGELATFSHTTKRL
PNLKAYDHLEVASVFAELNQVLSQYLSVVLDQTASKLPLEVRQYGIQVTPLPDKRLLESCQFVLAIKADT
TTDEIRRLVPAQLKLGPAEQIRDLINNQINGINVAPLSVVPRQIPYQTGYVYFEVVKKGPFWMRLKDSGG
IALHLSGHFPNPDIELWSINQ
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1517504-1516179 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
ATGATGCAATACTCCAAGACGGCTTGGTGCGAGGGGATGTTTCTGCGTCCCCAGCATTTTCAACAGCACG
AACGCGCAATATCTAATGAATATAAAGGCTTACACAGTTTAGGTGGCTCATATAACTGGGGCGTTTGGAA
TTGCCGTGTAAAAGAACATGCCTTAAAAACAGGCTTGATTGAACTTGATAATCTTCAAGCAATTCTTCCT
GATATGACGCTGATAGACTTTTCAGCAACAACAAGTTTTCTGTCTCCTTTAAAGGTAAAAAAAGGGACGG
AAAATACCTTAGTGAAGGTGATCGTTCCACTCTCAAAAGTCAGCAGTAAAATGATCGCGGATCCAAGTGA
AACAACGGTTTCTCGGTATTTACTTCAAGATCTAGACGTTATTGATAACCTGACGGGCCAAGATGAAGAA
ACGATTCAAGTGGCCTCATTAAATATCGAGCTGAAATCAAGCAATGAGCAGTTAACAGGTTATATAGAGC
TACCAATCCTTAAGATTAAAGAAGTTTCTACGGAAGGAGAGGTCATTCTTGATGACTCTTACGTACCACC
ACTTCTAAACTTGTTAAATGACAAGGTGATGACAGGGTATCTACGTAATGCAATGGCAATGACCAAGATA
CGCGCAGATGTTATCGCTCAACGACTTGTTAAAGGAAAAGCGGCTTCAGCATCTGCGGTAGATTTCATAA
TGCTGCAAATGTTGAATCGATATGAAGCCATATTGAAGCATTTTAGTGAGCTGGAGAAAGTACACCCCTT
AGAGCTTGCGACAACCTTTAAAGGCTACATAGGCGAGTTGGCAACGTTTTCTCACACCACCAAGCGCTTA
CCTAATCTCAAAGCTTACGATCACCTTGAAGTTGCAAGTGTGTTTGCTGAACTTAATCAAGTCCTTAGTC
AGTACTTGAGTGTCGTTCTTGATCAGACTGCAAGTAAGTTGCCACTAGAAGTACGCCAGTACGGTATCCA
AGTGACACCACTTCCAGATAAGCGACTATTGGAATCATGTCAGTTTGTATTGGCGATTAAAGCGGACACA
ACAACGGATGAGATTAGACGCTTAGTCCCTGCGCAATTGAAGCTGGGTCCGGCAGAGCAGATTAGAGATC
TAATCAACAACCAGATTAATGGAATTAACGTAGCTCCTTTAAGTGTCGTGCCACGACAGATTCCATATCA
AACGGGGTATGTTTATTTTGAGGTCGTTAAGAAGGGGCCATTCTGGATGCGACTTAAAGACAGCGGTGGT
ATTGCACTGCATTTATCTGGTCATTTCCCAAATCCGGACATAGAGCTTTGGAGCATTAATCAATAA