SecReT6
Protein ID: 525848300
SecReT6 ID825
T6SS typei5
Gene symbol-
Locus tagM634_23130
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1517526..1517981 [-]
Producttype VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDS5IXY4
KEGG IDvpf:M634_23130
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-40, Aligned region: 14..147
Protein Sequence: 151 a.a.     [Download]
>gi|525848300|ref|YP_008268940.1| type VI secretion lipoprotein/VasD [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MKQIYKSFFLFIFLVLMGCSAANLVVDPYADLEITANHNINPDSNGRPSPVVVYVFELTSNTLFESQDFF
SIYEEHEKVLGPDLVNKYEISLTPGQKEIYQASMSPKTEYLGIVAAFRDIENSNWRQVIKVDKTGYNTYQ
ISLEDLSLVVQ
 
Nucleotide Sequence: 456 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1517981-1517526 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
GTGAAACAAATTTATAAATCATTTTTTCTATTTATATTTTTAGTATTAATGGGATGCTCCGCCGCTAATT
TAGTGGTCGACCCATATGCGGATTTAGAAATAACGGCAAATCATAATATCAACCCTGACTCGAATGGAAG
ACCATCACCAGTCGTTGTATATGTATTTGAACTTACATCAAATACACTGTTTGAGAGCCAAGATTTTTTC
TCTATTTATGAGGAGCATGAAAAAGTACTCGGTCCAGACTTGGTGAATAAATATGAAATATCTTTGACAC
CAGGCCAAAAAGAAATCTACCAAGCTAGTATGTCTCCTAAAACAGAATATTTGGGTATCGTAGCCGCGTT
TCGCGATATTGAGAATTCAAATTGGCGACAAGTCATTAAAGTAGATAAGACGGGTTACAACACTTATCAA
ATCTCGTTAGAAGATCTGTCTTTGGTCGTACAATAA