SecReT6
Protein ID: 525848301
SecReT6 ID825
T6SS typei5
Gene symbol-
Locus tagM634_23135
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1517991..1519187 [-]
Productsignal peptide protein
NoteFha
UniProt IDS5J060
KEGG IDvpf:M634_23135
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.10E-16, Aligned region: 32..101
FHA [PF00498], Evalue: 3.10E-16, Aligned region: 376..386
Protein Sequence: 398 a.a.     [Download]
>gi|525848301|ref|YP_008268941.1| signal peptide protein [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MKLVLTITSFHKFTPEIESEFVFESSDEHAKVTFGRSEQCDWTLPDPERVISGTHGELIKFGDKYLIKDL
STNGTFVNNAVTPIGQGNELALSHGDTVALGDYQILISISDISEDRTEHQFTSTPEVKTSVGFEQHVESI
PEMEYFGLSAAELMDESVPSDFQLDIGLVDDFLEIPSHETEVPQPKVASMQPDTNAKSQKPTVHRGELEA
FIYGMGIDPNMVPSQNREQWFEQLGQSFSLMLIGLMETLHNRAVFKQTNRVNHTAFRKSENNPLKFSANL
EDAIHNLYNRQTSSFLKPNAAIKEAFNDIENHEQALMQGVAGTVSSVMSLVEPNTIYSDALAKDNVINKV
IPARKYAQSWKRFEGIHSQLTDELVNKESPFYLEDFAKHYELALKNKG
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1519187-1517991 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
ATGAAATTGGTATTGACCATAACGAGTTTCCACAAATTTACTCCAGAAATAGAGAGTGAGTTTGTGTTTG
AATCAAGTGATGAGCATGCAAAGGTAACTTTCGGACGCTCAGAACAATGTGACTGGACGTTACCAGACCC
AGAGAGAGTTATTTCTGGGACTCACGGCGAATTGATTAAATTTGGCGATAAATATCTAATTAAAGATTTA
TCAACAAATGGCACATTTGTTAATAATGCGGTTACTCCAATCGGCCAAGGGAATGAGCTTGCTTTGTCCC
ATGGTGACACTGTTGCTTTAGGCGATTATCAAATACTAATTAGTATTAGTGATATCTCTGAAGATAGGAC
AGAGCATCAATTTACATCTACACCAGAGGTTAAGACGTCAGTTGGATTCGAACAGCACGTGGAATCGATT
CCAGAGATGGAATATTTTGGTTTAAGTGCTGCCGAGTTGATGGATGAAAGTGTCCCATCAGATTTTCAGT
TAGACATTGGTCTAGTAGATGATTTTCTAGAAATTCCGAGTCACGAAACTGAAGTGCCACAACCTAAAGT
TGCATCAATGCAGCCTGATACCAACGCTAAAAGTCAAAAACCTACAGTGCATCGAGGTGAACTGGAAGCC
TTCATTTATGGCATGGGGATCGACCCCAATATGGTACCAAGCCAAAATCGAGAGCAGTGGTTTGAACAAT
TAGGTCAGTCGTTTTCTCTCATGCTTATTGGGCTAATGGAGACTCTTCACAATCGGGCTGTATTTAAACA
AACCAATCGCGTCAACCATACTGCATTTAGAAAGTCTGAAAATAATCCACTTAAGTTTTCAGCAAATTTG
GAAGATGCAATCCACAATTTGTATAACCGTCAAACGTCAAGTTTTTTAAAGCCTAATGCCGCAATAAAAG
AAGCATTTAACGATATTGAAAATCATGAGCAGGCTTTAATGCAAGGAGTAGCGGGTACGGTATCGAGTGT
CATGTCTCTCGTTGAACCTAATACTATTTATTCAGATGCATTGGCTAAAGACAATGTGATTAATAAGGTT
ATTCCAGCAAGAAAATATGCTCAGAGTTGGAAGCGCTTTGAAGGTATTCATAGCCAATTAACAGATGAAC
TTGTCAATAAAGAGTCTCCATTTTATTTAGAAGATTTTGCTAAGCACTACGAATTAGCGCTCAAGAATAA
AGGTTAA