SecReT6
Protein ID: 525848761
SecReT6 ID825
T6SS typei5
Gene symbol-
Locus tagM634_23120
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1514875..1516167 [-]
Productflagellar motor protein
NoteTssL
UniProt IDS5J1G3
KEGG IDvpf:M634_23120
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.70E-62, Aligned region: 49..254
OmpA [PF00691], Evalue: 9.10E-14, Aligned region: 251..270
OmpA [PF00691], Evalue: 9.10E-14, Aligned region: 322..420
Protein Sequence: 430 a.a.     [Download]
>gi|525848761|ref|YP_008268938.1| flagellar motor protein [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MEQTIVKPTPGGRAAVSKAQPQRSADSTVVISKSPELVNNDSVVAYGDNPLLAEANGLLSIIGQIRATAT
HSDPLFLKETLAQKLRDYENRLRQHDVDLETIDTARYCLCCSLDEAVLNTNWGSQSFWTHDSLLSSFYAS
SQGGEAFFKHLDSCLAHPESHLDLLELMYVCLSLGFIGQYRLEKNGLEAHRRLRKQVVSVLKSHGRGVQQ
ELSNKVEQHILAGAQVSERAPLWVVCSVTSALLVCIFMYFSYELNKASNQTFAQLVNLIQPTPAVSNPMV
ESKSAPIAERISMYLATEIGKDLVTVEALQDRVRISLKAQDLFESGSASVVAYIQPVISKVARTLEATQG
KIIITGHTDDRPIFTSKYPSNWHLSLARATSLSEQLISNSALKGRVIPEGLGDARPLVENDSEKNRAMNR
RIEIDLIVGN
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1516167-1514875 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
ATGGAACAGACGATAGTAAAACCTACTCCTGGCGGAAGAGCGGCTGTATCTAAAGCTCAGCCTCAAAGAT
CAGCAGACAGTACTGTTGTGATATCCAAAAGCCCTGAGTTGGTTAACAACGATTCAGTTGTTGCTTATGG
AGATAATCCACTATTGGCAGAAGCTAATGGTCTACTTTCGATTATTGGACAAATCAGAGCAACAGCTACT
CATTCCGATCCTTTGTTTCTTAAAGAAACGCTCGCGCAAAAACTTAGGGATTATGAGAATCGTCTGCGTC
AACATGATGTTGACTTGGAAACCATTGATACCGCACGTTATTGTCTGTGCTGTTCTTTAGACGAAGCAGT
ATTGAATACCAATTGGGGGAGTCAATCGTTTTGGACACATGATTCTCTGTTGAGTTCTTTTTACGCGAGC
AGCCAAGGTGGAGAGGCTTTTTTTAAGCATCTAGATAGCTGTTTGGCTCATCCGGAATCCCACCTAGATT
TACTAGAGCTAATGTACGTATGCTTATCTTTGGGTTTTATAGGTCAGTATCGTTTAGAAAAAAATGGGCT
TGAAGCTCACCGTAGATTGAGAAAACAAGTTGTATCAGTGCTTAAGTCACATGGTCGCGGAGTACAGCAA
GAGCTTAGTAACAAAGTAGAACAACATATATTGGCAGGTGCTCAGGTTTCGGAACGTGCTCCTCTATGGG
TGGTTTGTTCGGTAACTTCCGCACTGCTTGTTTGTATTTTTATGTACTTCAGCTACGAGTTGAACAAAGC
TTCCAACCAAACTTTTGCTCAATTGGTAAACCTGATTCAACCAACCCCAGCAGTTAGTAATCCTATGGTT
GAGTCAAAGTCAGCACCTATTGCCGAAAGAATATCTATGTATTTGGCAACGGAGATTGGCAAGGATCTTG
TCACTGTGGAAGCGTTGCAAGATAGAGTTCGTATTTCTCTTAAAGCTCAAGACCTATTTGAATCCGGTAG
TGCGAGCGTTGTGGCTTACATACAGCCAGTTATTTCTAAAGTTGCACGCACCTTAGAAGCGACACAAGGG
AAGATCATAATTACCGGGCATACCGATGACCGTCCGATATTTACCAGCAAGTACCCATCCAATTGGCACT
TGTCTTTAGCTCGGGCAACTTCTCTTTCCGAACAGTTAATCTCCAACAGTGCACTTAAAGGAAGAGTGAT
TCCTGAAGGGTTGGGTGATGCGAGACCTTTGGTAGAAAATGATAGTGAAAAGAACCGAGCAATGAATCGT
CGAATTGAAATCGATCTTATTGTGGGCAACTAA