SecReT6
Protein ID: 525853565
SecReT6 ID826
T6SS typei5
Gene symbol-
Locus tagM636_04530
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome II [GenBank: NC_021822] [Browse all T6SS(s) in this replicon]
Location [Strand]996100..996579 [-]
Producthemolysin D
NoteTssD
UniProt IDS5J241
KEGG IDvpk:M636_04530
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-30, Aligned region: 6..134
Protein Sequence: 159 a.a.     [Download]
>gi|525853565|ref|YP_008270149.1| hemolysin D [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MQSNTYLKYADIKGEATAEQYKDLITLLSVDWSVGREISSYTGTAMDREASATRLYDLTITKLQDRSSPD
LFKEATIGKGKPAVFHITKQGEKVEEIMKIELTDAMISNYSVSIQDDRPVETITISYTEMMMTVTPTDDK
NNTSAPLVYGYSGVKGQQM
 
Nucleotide Sequence: 480 bp     [Download]
>gi|525852846|ref|NC_021822.1|:c996579-996100 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome II, complete sequence
ATGCAGTCTAATACGTATCTTAAATACGCAGATATTAAAGGTGAAGCGACAGCGGAACAATATAAGGATT
TAATTACACTACTATCTGTAGATTGGAGTGTTGGTCGTGAAATTTCTTCTTACACGGGTACAGCAATGGA
CCGTGAAGCAAGTGCAACACGCCTATATGATTTAACTATCACTAAACTTCAAGATCGTTCGTCTCCTGAT
CTATTCAAGGAAGCAACAATCGGTAAAGGTAAACCTGCAGTATTCCACATCACTAAGCAGGGTGAAAAAG
TTGAAGAAATCATGAAAATCGAACTGACTGATGCGATGATTTCTAACTACTCAGTATCGATTCAAGATGA
TCGCCCAGTAGAAACTATCACAATTTCATACACTGAAATGATGATGACAGTGACACCTACTGATGACAAA
AACAACACTTCTGCTCCGTTGGTTTACGGTTACAGCGGTGTTAAAGGTCAACAAATGTAA