SecReT6
Protein ID: 525853566
SecReT6 ID826
T6SS typei5
Gene symbol-
Locus tagM636_04535
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome II [GenBank: NC_021822] [Browse all T6SS(s) in this replicon]
Location [Strand]996785..999352 [-]
ProductATPase
NoteTssH
UniProt IDS5JMD7
KEGG IDvpk:M636_04535
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.30E-39, Aligned region: 213..233
AAA_2 [PF07724], Evalue: 1.30E-39, Aligned region: 588..753
AAA [PF00004], Evalue: 1.30E-20, Aligned region: 160..205
AAA [PF00004], Evalue: 1.30E-20, Aligned region: 213..344
AAA [PF00004], Evalue: 1.30E-20, Aligned region: 593..711
AAA_16 [PF13191], Evalue: 4.30E-13, Aligned region: 190..234
AAA_16 [PF13191], Evalue: 4.30E-13, Aligned region: 256..291
AAA_16 [PF13191], Evalue: 4.30E-13, Aligned region: 478..480
AAA_16 [PF13191], Evalue: 4.30E-13, Aligned region: 561..628
AAA_16 [PF13191], Evalue: 4.30E-13, Aligned region: 657..686
AAA_5 [PF07728], Evalue: 1.80E-12, Aligned region: 213..235
AAA_5 [PF07728], Evalue: 1.80E-12, Aligned region: 592..713
ClpB_D2-small [PF10431], Evalue: 4.40E-11, Aligned region: 760..833
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 42..82
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 212..294
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 330..385
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 590..623
Sigma54_activat [PF00158], Evalue: 5.40E-08, Aligned region: 209..235
Sigma54_activat [PF00158], Evalue: 5.40E-08, Aligned region: 573..710
AAA_14 [PF13173], Evalue: 2.70E-07, Aligned region: 213..325
AAA_14 [PF13173], Evalue: 2.70E-07, Aligned region: 590..680
Clp_N [PF02861], Evalue: 5.20E-07, Aligned region: 24..74
Clp_N [PF02861], Evalue: 5.20E-07, Aligned region: 110..141
AAA_19 [PF13245], Evalue: 1.20E-06, Aligned region: 213..234
AAA_19 [PF13245], Evalue: 1.20E-06, Aligned region: 586..615
IstB_IS21 [PF01695], Evalue: 9.70E-06, Aligned region: 207..235
IstB_IS21 [PF01695], Evalue: 9.70E-06, Aligned region: 592..623
AAA_18 [PF13238], Evalue: 1.20E-05, Aligned region: 213..279
AAA_18 [PF13238], Evalue: 1.20E-05, Aligned region: 593..632
Arch_ATPase [PF01637], Evalue: 1.70E-05, Aligned region: 192..232
Arch_ATPase [PF01637], Evalue: 1.70E-05, Aligned region: 265..361
Arch_ATPase [PF01637], Evalue: 1.70E-05, Aligned region: 586..620
AAA_17 [PF13207], Evalue: 9.10E-05, Aligned region: 213..272
AAA_17 [PF13207], Evalue: 9.10E-05, Aligned region: 458..501
AAA_17 [PF13207], Evalue: 9.10E-05, Aligned region: 591..627
NTPase_1 [PF03266], Evalue: 9.90E-05, Aligned region: 213..235
NTPase_1 [PF03266], Evalue: 9.90E-05, Aligned region: 264..289
NTPase_1 [PF03266], Evalue: 9.90E-05, Aligned region: 592..629
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 213..233
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 584..633
AAA_29 [PF13555], Evalue: 0.00015, Aligned region: 205..229
AAA_29 [PF13555], Evalue: 0.00015, Aligned region: 586..603
AAA_25 [PF13481], Evalue: 0.00025, Aligned region: 213..286
AAA_25 [PF13481], Evalue: 0.00025, Aligned region: 588..614
AAA_25 [PF13481], Evalue: 0.00025, Aligned region: 655..676
NACHT [PF05729], Evalue: 0.0006, Aligned region: 213..241
NACHT [PF05729], Evalue: 0.0006, Aligned region: 592..616
T2SE [PF00437], Evalue: 0.001, Aligned region: 205..235
T2SE [PF00437], Evalue: 0.001, Aligned region: 580..624
UPF0079 [PF02367], Evalue: 0.0015, Aligned region: 213..233
UPF0079 [PF02367], Evalue: 0.0015, Aligned region: 579..621
RuvB_N [PF05496], Evalue: 0.0025, Aligned region: 211..232
RuvB_N [PF05496], Evalue: 0.0025, Aligned region: 279..293
RuvB_N [PF05496], Evalue: 0.0025, Aligned region: 547..613
RuvB_N [PF05496], Evalue: 0.0025, Aligned region: 660..686
AAA_30 [PF13604], Evalue: 0.0026, Aligned region: 210..235
AAA_30 [PF13604], Evalue: 0.0026, Aligned region: 465..487
AAA_30 [PF13604], Evalue: 0.0026, Aligned region: 586..620
TIP49 [PF06068], Evalue: 0.0027, Aligned region: 213..234
TIP49 [PF06068], Evalue: 0.0027, Aligned region: 282..291
TIP49 [PF06068], Evalue: 0.0027, Aligned region: 559..628
DUF258 [PF03193], Evalue: 0.0032, Aligned region: 209..232
DUF258 [PF03193], Evalue: 0.0032, Aligned region: 479..511
DUF258 [PF03193], Evalue: 0.0032, Aligned region: 576..603
RNA_helicase [PF00910], Evalue: 0.006, Aligned region: 214..234
RNA_helicase [PF00910], Evalue: 0.006, Aligned region: 593..616
RNA_helicase [PF00910], Evalue: 0.006, Aligned region: 693..711
Protein Sequence: 855 a.a.     [Download]
>gi|525853566|ref|YP_008270150.1| ATPase [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MASLSLSALVERLSPQAKETLEQAAAMASSRTHHSIELTHWLLAIVQHPSGIYSEVFEAFDIDERKVEEQ
LQAQLEKYKTGCQTVPGLSAYTVTMMQNALMCATIEFHEEQVNCIHLLFAYLSDDTLVNMMNAISAELDK
VEPSRLVAMKEHVGDGGNNTSKATSSSNSALNQFTTDLTEQAKAGKIDPVIGRDNEIRLMIDILLRRRQN
NPILTGEAGVGKTAVIEGLAQKIVDGDVPPALHDVAIKSLDLALLQAGAGMKGEFENRLKNLIREVNESS
QPIILFIDEAHGLIGGGGQAGQGDAANILKPALARGELRTIAATTWAEYKKYFEKDAALTRRFQVVKVDE
PTPELAVDMLRGLVNIMGQHHDVYITSQALNAAVQLSARYINGRQLPDKAVSVLDTACSRVALSQSATPG
ALDSKKKKLNIKEAEFQQLTKEAQLGVSHDELLNNIRYEIDELSNQVIELEAIWEQEKQWVQEAKSLRAR
VIEENADCDKERLQEIESNLALNAQPLVFSHVNESLIAEVISDWTGIPLGKLQDDEIEAVLNLKDSLCER
VVGQDHALEIMSEVIKTASAQLTDETKPNGVFLLTGPSGVGKTESALAIAEKVYGSEDNVTTINMSEFKE
EHKVSLLLGSPPGYVGYGEGGVLTEAVRRKPYSVILLDEMEKAHPGVQDIFYQVFDKGSIKDGEGRDIDF
KNTIIIMTANTGTETTMSLYADPDLAPEPEALKEALRDDLLTDFKPAFLGRVNVLPYLPLGKEVLTEITK
LKLNKVSNRIRKHYSAGLYFDEQLINDIVDNSNESGSGARVVQTTIENNLLPKISHEILNAILNGKTFDE
INVRGSIKELEVSLI
 
Nucleotide Sequence: 2568 bp     [Download]
>gi|525852846|ref|NC_021822.1|:c999352-996785 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome II, complete sequence
ATGGCTTCATTATCACTTTCAGCGTTGGTCGAAAGATTGTCTCCGCAAGCGAAGGAAACGCTAGAGCAAG
CGGCGGCAATGGCAAGTTCGCGTACACATCATAGTATAGAGTTGACCCACTGGTTGTTGGCGATAGTTCA
ACATCCATCCGGTATTTATTCAGAAGTGTTTGAAGCTTTTGATATTGATGAAAGAAAAGTCGAAGAACAA
CTGCAAGCTCAGCTTGAAAAATACAAAACTGGATGCCAAACCGTCCCAGGCCTTTCTGCTTATACTGTAA
CCATGATGCAGAATGCTTTGATGTGTGCAACGATAGAGTTTCATGAAGAACAAGTGAACTGTATCCACTT
ACTGTTTGCGTATCTTTCTGATGACACGCTAGTGAATATGATGAACGCTATTAGCGCGGAGCTAGACAAA
GTCGAACCATCTCGCCTAGTCGCAATGAAAGAGCATGTGGGCGATGGTGGAAACAATACTTCTAAGGCGA
CGAGCAGCTCGAACTCTGCATTGAATCAGTTCACAACGGATCTTACTGAGCAAGCTAAAGCTGGAAAAAT
AGATCCTGTTATCGGTCGCGACAATGAAATCCGCTTGATGATCGATATCTTATTGCGTCGCCGCCAAAAC
AATCCGATCTTAACGGGTGAGGCTGGTGTAGGTAAAACTGCGGTAATTGAGGGGCTGGCGCAAAAAATAG
TGGATGGGGATGTTCCTCCGGCTTTACATGATGTTGCCATCAAATCACTCGATCTTGCTTTGCTTCAGGC
GGGTGCGGGGATGAAAGGGGAGTTTGAAAACAGACTTAAAAATCTCATTCGAGAAGTTAACGAATCTTCG
CAGCCAATCATTCTTTTTATCGATGAAGCTCATGGTCTAATCGGAGGTGGTGGTCAAGCGGGACAAGGTG
ATGCTGCTAATATATTGAAACCAGCGTTGGCTCGAGGAGAGTTACGGACCATCGCTGCAACTACTTGGGC
TGAGTACAAAAAATATTTTGAAAAAGATGCCGCGTTAACGAGGCGCTTCCAGGTTGTGAAAGTAGACGAG
CCGACTCCTGAGTTAGCGGTAGATATGCTTAGAGGCTTGGTTAACATCATGGGGCAACATCATGATGTCT
ATATCACAAGCCAAGCACTGAATGCTGCGGTACAACTTTCTGCTCGCTACATTAACGGACGCCAACTGCC
AGATAAAGCAGTATCGGTATTAGATACAGCATGTTCGCGTGTTGCATTGAGCCAATCTGCCACGCCGGGC
GCGTTGGATAGCAAAAAGAAAAAGCTAAACATCAAAGAAGCTGAGTTTCAACAACTTACCAAAGAGGCTC
AATTGGGCGTAAGTCACGATGAACTGCTTAATAATATTCGGTATGAGATCGATGAGTTATCTAATCAAGT
CATAGAATTAGAGGCAATTTGGGAACAAGAAAAGCAGTGGGTTCAAGAAGCTAAGTCGTTGAGAGCTAGG
GTGATAGAAGAGAATGCCGACTGTGACAAAGAGCGATTACAGGAAATCGAATCGAACTTAGCTCTCAACG
CCCAACCTTTAGTCTTTTCTCATGTGAATGAATCTTTGATTGCTGAGGTGATTTCTGATTGGACAGGCAT
TCCACTTGGAAAATTGCAAGATGACGAAATTGAAGCGGTTCTTAACCTAAAAGATAGCTTGTGTGAGCGA
GTGGTGGGGCAAGATCATGCTCTAGAAATCATGTCCGAAGTGATCAAAACAGCAAGTGCCCAATTGACGG
ATGAAACTAAACCTAATGGCGTGTTTTTATTAACTGGCCCTAGTGGTGTCGGAAAAACGGAATCCGCTCT
TGCTATCGCAGAGAAAGTTTATGGGAGCGAAGACAACGTAACCACGATCAATATGTCGGAATTCAAAGAA
GAGCATAAGGTTTCATTGTTGTTAGGCTCTCCTCCTGGATATGTCGGATACGGTGAGGGGGGCGTTCTAA
CGGAAGCCGTAAGGCGTAAACCTTACAGTGTGATTCTGTTGGATGAAATGGAAAAAGCGCACCCCGGTGT
GCAAGATATTTTCTATCAAGTGTTTGATAAAGGCTCCATTAAAGATGGTGAAGGTCGAGATATCGATTTT
AAAAACACCATCATTATCATGACGGCGAATACTGGCACAGAAACCACAATGTCTCTCTATGCAGATCCAG
ACTTAGCGCCAGAACCGGAAGCTCTAAAAGAAGCGCTTAGAGATGATTTGCTAACAGATTTTAAACCTGC
ATTTTTGGGGCGAGTTAATGTATTACCTTACTTGCCTCTCGGAAAAGAAGTCCTAACGGAAATAACTAAG
TTAAAACTCAACAAAGTATCTAACCGTATCCGAAAACATTATTCGGCAGGGTTGTATTTTGATGAACAAC
TAATTAATGACATTGTAGACAATAGTAATGAGTCAGGAAGTGGTGCTCGTGTAGTTCAAACCACCATTGA
AAATAATTTACTTCCTAAAATTTCTCATGAAATATTGAATGCAATTCTTAATGGTAAGACGTTCGATGAA
ATTAATGTTAGAGGTTCAATTAAAGAACTAGAAGTCTCACTTATTTAA