SecReT6
Protein ID: 525853567
SecReT6 ID826
T6SS typei5
Gene symbol-
Locus tagM636_04540
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome II [GenBank: NC_021822] [Browse all T6SS(s) in this replicon]
Location [Strand]999363..1000328 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDS5J666
KEGG IDvpk:M636_04540
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-76, Aligned region: 8..307
Protein Sequence: 321 a.a.     [Download]
>gi|525853567|ref|YP_008270151.1| type VI secretion protein [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MSSEDFYRELKQRSLFEAIHLIEQELLKVESQIGTDALPKNEKLNLKVNASLGFENAQLVSTKPLGKDKL
ALETNLIGLTGEQGVLPQHYSELALHRLKEGDHAMVDFYDIFNHRLLSLYYRSWQLSQLTIQARAHAKNQ
RSPLTDCMSSLTGDGNDLALHYGGMYASPTRSKGALKSILECLSGCQIRIHEFQGQWMRLSKSEQTRLAS
KSMPEGQFAQLGAGASLGKRAWNINASTTIEFLPKERKQVKNLLPKTNTLKTIKQVAGDFIGKHKHVKWQ
LTTKHSLLPQVQISKQQGQLGVGSVLKKHERTEDRNITITV
 
Nucleotide Sequence: 966 bp     [Download]
>gi|525852846|ref|NC_021822.1|:c1000328-999363 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome II, complete sequence
ATGAGCTCAGAGGACTTCTACCGCGAGCTAAAGCAACGTTCTTTGTTTGAAGCTATTCATCTTATTGAGC
AAGAGCTTTTGAAAGTTGAATCGCAAATTGGAACAGATGCATTACCAAAAAACGAGAAACTTAACTTAAA
GGTCAATGCGTCTTTAGGGTTTGAGAATGCGCAACTCGTTTCTACTAAACCATTAGGTAAAGATAAATTA
GCGCTTGAGACAAATTTGATTGGCTTGACGGGGGAGCAGGGTGTACTGCCTCAGCATTACAGTGAGCTTG
CATTACATCGACTGAAAGAAGGCGATCATGCGATGGTGGACTTCTATGACATTTTTAACCATCGGCTTTT
ATCCCTCTATTATCGAAGTTGGCAATTGAGTCAGTTAACCATACAAGCGCGTGCGCATGCAAAAAATCAG
CGCTCCCCATTGACTGATTGCATGTCGTCATTGACTGGCGATGGGAATGATCTTGCACTGCATTATGGCG
GCATGTATGCATCTCCAACACGAAGTAAAGGTGCATTGAAGAGCATTTTGGAATGTTTGTCTGGTTGCCA
AATTCGTATTCACGAGTTTCAAGGTCAATGGATGCGACTGTCTAAATCTGAACAAACTCGTTTGGCATCG
AAAAGTATGCCCGAAGGCCAGTTTGCACAACTCGGTGCTGGTGCGTCACTAGGGAAAAGAGCCTGGAATA
TCAATGCAAGTACAACAATTGAGTTTCTCCCAAAGGAAAGAAAGCAAGTCAAAAATCTGTTACCCAAGAC
CAATACATTGAAAACGATAAAACAGGTAGCAGGTGACTTCATTGGCAAACACAAGCACGTTAAATGGCAA
CTCACGACTAAACATAGTCTATTGCCTCAAGTTCAAATATCTAAGCAACAAGGTCAGTTAGGTGTCGGCT
CTGTACTGAAAAAACATGAACGTACGGAAGATCGCAACATAACAATTACGGTTTAA