SecReT6
Protein ID: 525853568
SecReT6 ID826
T6SS typei5
Gene symbol-
Locus tagM636_04545
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome II [GenBank: NC_021822] [Browse all T6SS(s) in this replicon]
Location [Strand]1000325..1002148 [-]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDS5J880
KEGG IDvpk:M636_04545
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.40E-191, Aligned region: 5..607
Protein Sequence: 607 a.a.     [Download]
>gi|525853568|ref|YP_008270152.1| type VI secretion system protein ImpG [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MSEEFLKYYNRELAYLRHKGQEFGEQYPKIAARLRISEEQVEDPHVERLLEGCAFLTARIRQSLDNSYPQ
FTESLMGQLYPDFHAPIPSMSVIKLNCSESTTSSFAIPVGERVEVSAPGYQDCQFRTGYPTTMYPLDIIS
GSFENAPFKPTGSKWEHNAHSVLRCQLSAHDSESSINSMGIDCLRLYLNGQTQLTLKLYQMLFQSLIGLS
IVLDGKEIMPLTKRHLQSVGFGDEEQVVPYSKRSFSGSRLLVEYLHFPEKFMFFDLIELGLDKLEIQGQV
EICFYFDTSDDWLPKQVDEESVMVGCVPIVNLFKSTMEPKRLLPTEYEYQLSPQYQDAESNEVVSISDVT
LRNWNKTYEHLPCYHSGEHTHYMSASEVYWLMRREDKNWAGGYDEPGRETYVSFVDKQYQLFSPESRDNW
LMYVEAECCNRNLPQKIPFGGGLPKVQLPNVDDNFKSIRCLTSLSETLRPEMDESTRWQLTKLLTLNHFT
EADGLATLKQTLNLYAFAGTPETKAVIDALVKLEFEHTTGRVSQKGKVGFAHGVKLVLTVSDQILPKEQI
FLLGSVLSVYFAQYAEINVFTQLEIKLKSTSSSFHVWPALTGDKVLL
 
Nucleotide Sequence: 1824 bp     [Download]
>gi|525852846|ref|NC_021822.1|:c1002148-1000325 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome II, complete sequence
ATGAGTGAAGAGTTTCTAAAATACTACAATCGTGAATTGGCCTATCTGCGACACAAAGGACAAGAGTTTG
GCGAGCAATATCCTAAAATTGCGGCTAGGTTACGTATCAGCGAAGAACAAGTTGAAGACCCACATGTTGA
ACGTCTGTTGGAAGGTTGTGCTTTTTTAACCGCTCGGATAAGACAAAGTCTGGATAACAGTTACCCACAG
TTTACGGAATCACTGATGGGACAGTTATATCCGGACTTTCATGCGCCAATTCCTTCGATGTCAGTAATCA
AATTGAACTGTTCAGAGTCAACCACTAGTTCATTTGCTATTCCTGTGGGTGAAAGAGTCGAAGTTAGTGC
CCCTGGATATCAAGATTGCCAGTTTCGAACCGGTTACCCGACAACAATGTATCCACTCGATATTATCTCT
GGTTCATTTGAGAACGCGCCTTTCAAGCCTACTGGCTCTAAGTGGGAGCACAATGCGCACTCTGTACTAA
GGTGTCAGCTGAGTGCTCATGATTCAGAGTCATCTATCAATTCCATGGGTATCGATTGTTTGCGTTTGTA
CTTAAATGGACAGACGCAATTAACACTCAAGCTATATCAAATGTTATTCCAAAGTTTGATTGGTCTTTCA
ATCGTGTTGGATGGTAAAGAAATCATGCCTCTAACTAAGAGGCATCTTCAATCGGTTGGTTTTGGGGACG
AGGAGCAAGTCGTTCCTTACAGTAAGAGAAGTTTTTCGGGATCTCGTTTATTGGTCGAGTACCTTCATTT
CCCAGAAAAATTCATGTTCTTTGACTTGATTGAGCTCGGCTTAGATAAGTTAGAGATTCAAGGGCAGGTC
GAGATTTGCTTTTACTTCGATACAAGCGATGACTGGCTACCAAAGCAAGTAGACGAGGAAAGTGTCATGG
TTGGCTGTGTTCCCATTGTAAATCTGTTCAAATCAACCATGGAACCTAAACGTCTCCTTCCAACAGAGTA
CGAGTATCAATTATCTCCTCAGTACCAAGATGCAGAGAGTAATGAAGTTGTCTCGATTTCTGATGTTACC
TTGAGAAACTGGAACAAAACTTACGAGCATTTACCCTGTTACCATTCAGGAGAGCACACGCACTACATGA
GCGCGAGTGAAGTGTATTGGTTAATGAGACGAGAGGATAAAAACTGGGCCGGTGGCTACGATGAGCCTGG
TCGAGAGACTTATGTTTCTTTTGTTGATAAGCAATACCAGTTGTTCAGCCCTGAAAGCAGAGATAATTGG
CTGATGTATGTGGAAGCTGAGTGTTGCAATCGTAATTTGCCACAAAAAATTCCATTTGGTGGCGGGCTAC
CAAAGGTTCAGTTACCCAATGTTGATGATAATTTTAAATCAATTAGGTGCTTAACGTCTCTCTCCGAAAC
GCTTAGGCCAGAGATGGATGAAAGCACACGATGGCAGCTTACCAAGCTATTAACATTGAACCATTTTACT
GAAGCTGACGGCTTAGCAACGTTAAAACAAACATTGAACTTGTATGCATTTGCAGGCACCCCCGAAACAA
AAGCCGTTATAGATGCTCTAGTCAAGCTAGAGTTTGAACATACAACCGGTAGGGTTAGTCAGAAAGGAAA
AGTTGGTTTTGCACATGGAGTAAAGCTGGTTCTAACAGTATCCGATCAGATACTGCCAAAAGAGCAGATC
TTTTTATTGGGTAGCGTGTTATCTGTTTACTTTGCTCAATATGCGGAGATTAACGTGTTTACGCAGTTAG
AGATAAAGTTGAAATCAACCAGCAGCTCCTTTCACGTATGGCCTGCGCTGACAGGTGATAAGGTGTTGTT
ATGA