SecReT6
Protein ID: 525853569
SecReT6 ID826
T6SS typei5
Gene symbol-
Locus tagM636_04550
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome II [GenBank: NC_021822] [Browse all T6SS(s) in this replicon]
Location [Strand]1002145..1002609 [-]
Productlysozyme
NoteTssE
UniProt IDS5JHP0
KEGG IDvpk:M636_04550
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.90E-20, Aligned region: 27..129
Protein Sequence: 154 a.a.     [Download]
>gi|525853569|ref|YP_008270153.1| lysozyme [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MALTVSLLDKLIDSDPTTREEKDFPVSQQHMLNGLLRDLESMLNSRIGWKNIHEDFLEVRYSILNYGLPD
FSSMPYSSQDGQSQLCDIVYEAIREFEPRLRNPHVQISDEKNAIDRTLRLEISATCLIDNDIHELKFNSE
VEPVNLGMKLSRAK
 
Nucleotide Sequence: 465 bp     [Download]
>gi|525852846|ref|NC_021822.1|:c1002609-1002145 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome II, complete sequence
ATGGCTTTAACGGTTTCACTGCTAGACAAGTTGATTGATAGCGACCCAACTACCAGAGAAGAAAAAGATT
TTCCTGTCAGTCAGCAACACATGCTCAATGGTTTGTTAAGAGACTTAGAGTCGATGCTTAATAGTCGTAT
TGGTTGGAAAAATATTCACGAAGACTTTTTAGAAGTTAGATACTCAATTCTGAACTATGGGTTACCTGAT
TTTTCTTCAATGCCTTATAGCAGCCAAGATGGACAAAGTCAGTTGTGTGACATCGTTTATGAAGCTATTC
GGGAGTTTGAACCTCGGTTAAGAAATCCGCACGTTCAAATTTCTGATGAAAAAAATGCGATAGATCGAAC
CTTACGGTTAGAAATTAGCGCAACTTGTTTGATTGATAATGATATCCACGAGTTGAAATTCAATTCGGAA
GTCGAGCCTGTGAACTTAGGAATGAAGTTGAGTCGAGCGAAATGA