SecReT6
Protein ID: 525853570
SecReT6 ID826
T6SS typei5
Gene symbol-
Locus tagM636_04555
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome II [GenBank: NC_021822] [Browse all T6SS(s) in this replicon]
Location [Strand]1002618..1003415 [-]
Productprotein of avirulence locus ImpE
NoteTagJ
UniProt IDS5J246
KEGG IDvpk:M636_04555
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.90E-40, Aligned region: 138..259
TPR_19 [PF14559], Evalue: 5.60E-05, Aligned region: 7..63
TPR_11 [PF13414], Evalue: 0.00025, Aligned region: 7..62
TPR_14 [PF13428], Evalue: 0.0023, Aligned region: 8..34
TPR_14 [PF13428], Evalue: 0.0023, Aligned region: 40..66
TPR_14 [PF13428], Evalue: 0.0023, Aligned region: 71..89
Protein Sequence: 265 a.a.     [Download]
>gi|525853570|ref|YP_008270154.1| protein of avirulence locus ImpE [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MTQWKNALSEGQLQQALELLIEAIKASPKDASLRSSFIELLCIDGDFERADEQLMQSIKLFPEYLPGASQ
LRHLVKAAQARKDFAQGAATAKVLCENEELTKSLVSFNLSMVSQDYEQVSELALQIEELRQEKGFLANDT
SFSDVRDIDDRLGGYIELFSTAGNYFLVPIASINTLEIKSATSLLESVWRPVEFDIDGLGEGEGHMPMTY
VDSESDAQKLGRETDWKQIADKEVYLGLGLKCWLVGEMALPISDLQNLQVIKELA
 
Nucleotide Sequence: 798 bp     [Download]
>gi|525852846|ref|NC_021822.1|:c1003415-1002618 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome II, complete sequence
ATGACTCAGTGGAAAAATGCCTTATCGGAAGGGCAGTTGCAACAAGCTTTAGAGCTACTAATCGAAGCAA
TAAAGGCATCTCCAAAGGATGCCAGTTTGAGAAGCTCTTTTATTGAACTGCTTTGTATTGATGGTGATTT
TGAGCGAGCTGATGAGCAACTGATGCAGTCTATTAAACTGTTTCCTGAATATCTTCCAGGCGCTAGCCAG
TTAAGACATCTGGTTAAAGCTGCTCAAGCGCGAAAGGATTTCGCTCAAGGTGCGGCAACCGCGAAGGTAT
TGTGTGAGAACGAAGAACTAACTAAGTCATTGGTTAGCTTCAACTTATCAATGGTGAGTCAAGATTATGA
ACAAGTTTCTGAACTTGCTCTTCAAATCGAAGAACTGAGACAAGAAAAAGGCTTTTTAGCTAATGATACT
TCGTTCTCAGACGTGCGGGATATTGATGATCGTTTAGGTGGTTACATTGAGCTGTTTTCTACCGCAGGCA
ACTACTTCCTCGTCCCTATTGCTAGCATCAACACTTTAGAAATCAAATCTGCTACCTCTTTGCTAGAAAG
TGTTTGGCGCCCCGTTGAGTTTGACATTGACGGTTTAGGTGAAGGTGAAGGCCATATGCCGATGACTTAC
GTGGATTCAGAAAGTGATGCTCAAAAACTAGGTCGTGAAACGGATTGGAAACAAATAGCTGACAAAGAAG
TTTACTTAGGTTTAGGTCTGAAGTGTTGGCTTGTCGGTGAAATGGCGCTGCCGATTTCTGACTTACAAAA
TCTACAAGTAATAAAAGAGTTGGCGTAA