SecReT6
Protein ID: 525853572
SecReT6 ID826
T6SS typei5
Gene symbol-
Locus tagM636_04565
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome II [GenBank: NC_021822] [Browse all T6SS(s) in this replicon]
Location [Strand]1004993..1006486 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDS5J674
KEGG IDvpk:M636_04565
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.30E-184, Aligned region: 63..493
Protein Sequence: 497 a.a.     [Download]
>gi|525853572|ref|YP_008270156.1| EvpB family type VI secretion protein [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MTTQVEKQLDPTVGEQTTSFLEQAIGATKQTEASRAEELIKTLTEEAMKGTVSWNKNLTVTFREAINLLD
RQISEQLSEVMHHPELQKLEGSWRGLNYLVMNSETSSTLKIRMISITKKELHKDLSKAVEFDQSQIFKKV
YESEFGSAGGEPYGALIGDYEFTNHPEDIESLRLMSNVAASGFSPFLSAASPALFGFDEWTELSKPRDLD
KVFESLEYAQWRSFRESADSRFVSLTMPKVLARLPYGQATSPVEAFGFEEFDVDPVSGIAVNADHNDYCW
MNSSYVLGVKLTDAFSKYGFCTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITDRREAELGKLG
FLPLCHYKNTNYAVFFGAQTCQKPANHESPEVAANAAISARLPYMMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVKEIPGSPGSYNAVAWLKPWLQMEELTTSLRLVA
KIPQSGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|525852846|ref|NC_021822.1|:c1006486-1004993 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome II, complete sequence
ATGACGACTCAAGTTGAAAAACAACTCGATCCTACGGTGGGTGAACAAACCACTTCATTTCTTGAACAGG
CTATTGGTGCGACGAAACAAACAGAAGCATCGAGAGCAGAAGAGCTGATCAAGACACTGACTGAAGAAGC
TATGAAGGGGACGGTTTCTTGGAATAAAAACCTAACCGTAACTTTCCGTGAAGCGATTAATTTGCTTGAT
AGACAGATTTCAGAGCAGCTTTCTGAAGTTATGCACCATCCTGAGCTACAAAAGTTAGAAGGCTCATGGC
GTGGGCTGAATTACTTAGTCATGAATTCTGAGACAAGTTCTACGCTGAAAATTCGCATGATCAGCATCAC
GAAGAAAGAGCTTCATAAAGACTTAAGTAAAGCGGTTGAATTCGATCAAAGTCAAATCTTTAAAAAAGTG
TACGAATCTGAATTTGGTAGCGCTGGTGGTGAACCGTATGGTGCTTTAATTGGTGACTACGAGTTTACAA
ACCATCCAGAAGATATTGAGTCTTTGCGTTTAATGTCGAATGTTGCTGCTTCGGGTTTCTCACCATTCTT
GTCTGCTGCTTCTCCTGCGCTATTTGGTTTTGATGAGTGGACAGAACTATCTAAACCGCGCGATTTAGAT
AAAGTCTTTGAGTCGTTGGAATATGCGCAATGGCGCTCTTTCCGTGAAAGTGCAGATTCTCGTTTTGTAA
GCTTAACGATGCCTAAAGTATTAGCCCGCCTACCATACGGCCAAGCTACGTCTCCTGTAGAAGCGTTTGG
CTTTGAAGAGTTTGATGTGGATCCTGTGTCGGGTATCGCCGTTAATGCTGATCACAATGATTATTGTTGG
ATGAACTCATCGTACGTGCTTGGCGTCAAACTGACGGATGCATTTTCTAAGTATGGTTTCTGTACTGCTA
TTCGTGGCGCAGAGGGTGGTGGTCGAGTTGATAACCTACCAACACACTTCTTCATGAGTGATGATGGTGA
TCCAGATATGAAGTGCCCAACGGAAATTGGCATTACAGACCGCCGTGAAGCGGAATTGGGTAAACTGGGT
TTCTTACCGTTGTGTCACTACAAAAATACAAACTATGCCGTGTTCTTTGGTGCTCAAACTTGTCAAAAAC
CAGCAAATCATGAATCTCCAGAAGTGGCAGCAAACGCGGCAATTTCAGCAAGACTTCCTTACATGATGGC
AACCTCTCGTTTTGCACATTATTTGAAAGTAATGGCTCGAGACAAGATCGGTAGCTTTATGGAAGCAGAA
GACGTTGAATCTTGGTTGAACCGTTGGATTCTTGGCTATGTGAACGCTTCTGAAGGTGGCGGTCAAGAAA
TTCGTGCGAAATACCCTCTTGCCGACGCTCGCGTACAAGTTAAGGAGATTCCAGGTTCTCCTGGTTCTTA
CAACGCGGTTGCTTGGCTCAAACCATGGCTTCAAATGGAAGAGCTAACCACGTCTTTAAGACTCGTTGCT
AAAATTCCTCAGTCGGGTGGCTAA