SecReT6
Protein ID: 525853573
SecReT6 ID826
T6SS typei5
Gene symbol-
Locus tagM636_04570
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome II [GenBank: NC_021822] [Browse all T6SS(s) in this replicon]
Location [Strand]1006486..1007016 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDS5J886
KEGG IDvpk:M636_04570
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.50E-62, Aligned region: 8..162
Protein Sequence: 176 a.a.     [Download]
>gi|525853573|ref|YP_008270157.1| type VI secretion protein [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MTSIHSKLSRVRKPRVHITYDVETEGTTLKKELPFVVGVMGDFAGQNTEALKPLKDRRFIQIDRDNFDDV
LKKMSPSVKFKVANKLANDDSEFAVELSFKSMQDFEPAAIVNQVEPLRQLMETRNKLRDLMTKVDRSEEL
ENILEEVLNNTDNLAKLAGELDLGKKAPSESTEGAE
 
Nucleotide Sequence: 531 bp     [Download]
>gi|525852846|ref|NC_021822.1|:c1007016-1006486 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome II, complete sequence
ATGACGAGTATCCACTCGAAACTTTCACGAGTACGGAAGCCTCGTGTTCACATTACCTACGATGTTGAAA
CCGAAGGAACAACTTTGAAAAAAGAGCTTCCTTTTGTGGTGGGTGTTATGGGCGACTTTGCAGGCCAAAA
TACCGAAGCATTGAAACCATTAAAGGATCGCCGTTTCATTCAAATCGATCGTGATAACTTCGATGATGTA
CTTAAAAAGATGAGTCCATCGGTTAAGTTCAAAGTCGCAAACAAGTTAGCAAATGACGATTCTGAATTTG
CGGTTGAACTGAGCTTTAAATCGATGCAAGACTTTGAACCAGCAGCGATTGTCAATCAAGTAGAACCATT
GCGTCAGCTGATGGAAACTCGTAACAAACTGCGAGACTTGATGACTAAAGTCGACCGTTCGGAAGAACTT
GAAAACATCCTAGAAGAAGTTCTCAACAATACAGACAATTTGGCAAAACTAGCTGGTGAGCTAGATCTTG
GCAAAAAAGCGCCATCAGAAAGTACTGAGGGAGCAGAATAA