SecReT6
Protein ID: 525853574
SecReT6 ID826
T6SS typei5
Gene symbol-
Locus tagM636_04575
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome II [GenBank: NC_021822] [Browse all T6SS(s) in this replicon]
Location [Strand]1007032..1008153 [-]
Producttype VI secretion protein
NoteTssA
UniProt IDS5JHP4
KEGG IDvpk:M636_04575
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.90E-20, Aligned region: 67..127
Protein Sequence: 373 a.a.     [Download]
>gi|525853574|ref|YP_008270158.1| type VI secretion protein [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MSNTMFDWYEQVLAPISEDNPTGIDPREDVSPQSAYYRLKDQRMVARNAERNAIIEEESIHTHNNLWRVF
VEEVPEVLATQSKDFEFVAWLIEALTRLYGFRGMGVGYKIASAFVESYWDELHPMPDEDGIETRISAITG
LNGIDSEGTLIFPLASIPLTDMGVEQAYAYWEYQQAIELERLDEDKRRARVDQGAIELSRITDTVKSTSD
EFYQSLIADLEFATGAFNEFSQRLDDAVGDVTPSSYISKRIESIHAALKHLLGNRFKDKAEVSISDENGD
EELEEASQQAVTHNSSALLVTNMQSREQAIQQLQHVADFFRESEPHSPVSYSIEQIIRWCGMPLPELLAE
LISDGDAKRSYFRLVGIAEQNEN
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|525852846|ref|NC_021822.1|:c1008153-1007032 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome II, complete sequence
ATGAGTAACACGATGTTTGATTGGTATGAGCAAGTCCTTGCACCAATTTCGGAAGACAATCCGACTGGCA
TTGATCCAAGAGAGGATGTCTCTCCTCAGTCTGCTTATTATCGACTTAAAGATCAGCGAATGGTGGCAAG
AAACGCAGAGCGAAACGCCATCATCGAAGAAGAGAGTATTCATACACATAACAACTTATGGCGCGTTTTT
GTTGAAGAAGTACCAGAAGTTCTCGCTACACAATCAAAAGATTTTGAGTTTGTTGCCTGGCTAATAGAAG
CATTAACTCGGCTTTATGGTTTTAGAGGCATGGGCGTAGGCTACAAAATTGCTAGCGCGTTTGTTGAGTC
ATATTGGGATGAGCTGCACCCAATGCCTGATGAAGACGGCATAGAAACGCGGATTTCTGCCATCACCGGA
CTTAATGGTATTGATAGTGAGGGAACGCTGATCTTTCCTCTTGCCTCGATTCCATTGACGGATATGGGTG
TAGAGCAAGCTTATGCATATTGGGAATACCAACAAGCTATTGAACTCGAGCGCTTGGACGAAGACAAGCG
AAGAGCACGAGTAGATCAAGGCGCAATTGAATTGTCACGTATCACTGACACTGTGAAATCAACTTCTGAT
GAGTTTTACCAGTCTCTGATTGCAGATCTCGAGTTCGCTACAGGTGCTTTTAATGAGTTCAGTCAGCGAC
TTGATGACGCTGTAGGGGATGTAACGCCTAGCTCATATATTTCAAAAAGAATTGAATCAATACACGCGGC
ACTTAAGCACTTGTTGGGTAATCGTTTTAAGGATAAGGCTGAGGTCTCCATTTCTGACGAAAATGGTGAT
GAAGAGTTAGAAGAAGCAAGTCAACAAGCAGTTACTCACAACTCATCTGCGTTATTAGTTACAAACATGC
AATCTCGAGAACAAGCTATTCAACAGTTGCAACATGTGGCGGACTTTTTTAGAGAAAGCGAGCCTCACTC
ACCAGTTTCTTACTCCATCGAACAAATTATTCGTTGGTGTGGAATGCCTCTGCCTGAATTACTGGCGGAA
CTAATCTCCGACGGAGACGCAAAACGAAGCTACTTCCGTTTGGTTGGCATAGCAGAACAAAATGAAAATT
AA