SecReT6
Protein ID: 525853578
SecReT6 ID826
T6SS typei5
Gene symbol-
Locus tagM636_04605
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome II [GenBank: NC_021822] [Browse all T6SS(s) in this replicon]
Location [Strand]1015810..1016265 [-]
Producttype VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDS5J893
KEGG IDvpk:M636_04605
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-40, Aligned region: 14..147
Protein Sequence: 151 a.a.     [Download]
>gi|525853578|ref|YP_008270163.1| type VI secretion lipoprotein/VasD [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MKQIYKSFLLFIFLVLMGCSAANLVVDPYADLEITANHNINPDSNGRPSPVVVYVFELTSNTLFESQDFF
SIYEEHEKVLGPDLVNKYEISLTPGQKEIYQASMSPKTEYLGIVAAFRDIENSNWRQVIKVDKTGYNTYQ
ISLEDLSLVVQ
 
Nucleotide Sequence: 456 bp     [Download]
>gi|525852846|ref|NC_021822.1|:c1016265-1015810 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome II, complete sequence
GTGAAACAAATTTATAAATCATTTTTGCTTTTTATATTTTTAGTATTAATGGGATGCTCCGCCGCTAATT
TAGTGGTCGACCCATATGCGGATTTAGAAATAACGGCAAATCATAATATCAACCCTGACTCGAATGGAAG
ACCGTCACCAGTTGTTGTATATGTATTTGAACTTACATCAAATACACTGTTTGAGAGCCAAGATTTTTTC
TCTATTTATGAGGAGCATGAAAAAGTACTCGGTCCAGACTTGGTGAATAAATATGAAATATCTTTGACAC
CAGGCCAAAAAGAAATCTACCAAGCTAGTATGTCTCCTAAAACAGAATATTTGGGTATCGTAGCCGCGTT
TCGCGATATTGAGAATTCAAATTGGCGACAAGTCATTAAAGTAGATAAGACGGGTTACAACACTTATCAA
ATCTCGTTAGAAGATCTGTCTTTGGTCGTACAATAA