SecReT6
Protein ID: 525853579
SecReT6 ID826
T6SS typei5
Gene symbol-
Locus tagM636_04610
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome II [GenBank: NC_021822] [Browse all T6SS(s) in this replicon]
Location [Strand]1016275..1017471 [-]
Productsignal peptide protein
NoteFha
UniProt IDS5JHQ4
KEGG IDvpk:M636_04610
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.10E-16, Aligned region: 32..101
FHA [PF00498], Evalue: 3.10E-16, Aligned region: 376..386
Protein Sequence: 398 a.a.     [Download]
>gi|525853579|ref|YP_008270164.1| signal peptide protein [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MKLVLTITSFHKFTPEIESEFVFESSDEHAKVTFGRSEQCDWTLPDPERVISGTHGELIKFGDKYLIKDL
STNGTFVNNAVTPIGQGNELALSHGDTVALGDYQIQISISDISEDRTEHQFTSNPEVKTPVGFEQHVESI
PEMEDFGLSAAELMDESVPSDFQLDIGLVDDFLEIPSHETEVPQPKVASMQPDTNAKSQKPTVHRGELEA
FIYGMGIDPNMVPSQNREQWFEQLGQSFSLMLIGLMETLHNRAVFKQTNRVNHTAFRKSENNPLKFSANL
EDAIHNLYNRQTSSFLKPNAAIKEAFNDIENHEQALMQGVAGTVSSVMSLVEPNTIYSDALAKDNVINKV
IPARKYAQSWKRFEGIHSQLTDELVNKESPFYLEDFAKHYELALKNKG
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|525852846|ref|NC_021822.1|:c1017471-1016275 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome II, complete sequence
ATGAAATTGGTATTGACCATAACGAGTTTCCACAAATTTACTCCGGAAATAGAGAGTGAGTTTGTGTTTG
AATCAAGTGATGAGCATGCAAAGGTAACCTTCGGACGCTCAGAACAATGTGACTGGACGTTACCAGACCC
TGAGAGAGTTATTTCTGGGACTCACGGCGAATTGATTAAATTTGGCGATAAATATCTAATTAAAGATTTA
TCAACAAATGGCACATTTGTTAATAATGCAGTTACTCCAATCGGCCAAGGGAATGAGCTTGCTTTGTCCC
ATGGTGACACTGTTGCTTTAGGCGATTATCAAATACAAATTAGTATTAGTGATATCTCTGAAGATAGGAC
AGAGCATCAATTTACATCTAACCCAGAGGTTAAGACGCCAGTTGGATTCGAACAGCACGTAGAATCGATT
CCAGAGATGGAAGATTTTGGTTTAAGCGCTGCCGAGTTGATGGATGAAAGTGTCCCATCAGATTTTCAGT
TAGACATTGGTCTAGTAGATGATTTTCTAGAAATTCCGAGTCACGAAACTGAAGTGCCACAACCTAAAGT
TGCATCAATGCAGCCTGATACCAACGCTAAAAGTCAAAAACCTACAGTGCATCGAGGTGAACTGGAAGCC
TTCATTTATGGCATGGGGATCGACCCCAATATGGTACCAAGCCAAAATCGAGAGCAGTGGTTTGAACAAT
TAGGTCAGTCGTTTTCTCTCATGCTTATTGGGCTAATGGAGACTCTTCACAATCGGGCTGTATTTAAACA
AACCAATCGCGTCAACCATACTGCATTTAGAAAGTCTGAAAATAATCCACTTAAGTTTTCAGCAAATTTA
GAAGATGCAATACACAATTTGTATAACCGTCAAACGTCAAGTTTTTTAAAGCCTAATGCCGCAATAAAAG
AAGCATTTAACGATATTGAAAATCATGAGCAGGCTTTAATGCAAGGAGTAGCGGGTACGGTATCGAGTGT
CATGTCTCTCGTTGAACCTAATACTATTTATTCAGATGCATTGGCTAAAGACAATGTAATTAACAAGGTT
ATTCCAGCAAGAAAATATGCTCAGAGTTGGAAGCGCTTTGAAGGTATTCATAGCCAATTAACAGATGAAC
TTGTCAATAAAGAGTCTCCATTTTATTTAGAAGATTTTGCTAAGCACTACGAATTAGCGCTCAAGAATAA
AGGTTAA