SecReT6
Protein ID: 525854370
SecReT6 ID826
T6SS typei5
Gene symbol-
Locus tagM636_04595
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome II [GenBank: NC_021822] [Browse all T6SS(s) in this replicon]
Location [Strand]1013160..1014452 [-]
Productflagellar motor protein
NoteTssL
UniProt IDS5J4E1
KEGG IDvpk:M636_04595
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.90E-61, Aligned region: 49..254
OmpA [PF00691], Evalue: 5.20E-14, Aligned region: 251..270
OmpA [PF00691], Evalue: 5.20E-14, Aligned region: 322..420
Protein Sequence: 430 a.a.     [Download]
>gi|525854370|ref|YP_008270162.1| flagellar motor protein [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MEQTIVKPTPGGRAAVSKAQPQRSADSTVVISKSPELVNNDSVVAYGDNPLLAEANGLLSIIGQIRATAT
HSDPLFLKETLAQKLRDYENRLRQHDVDLETIDTARYCLCCSLDEAVLNTNWGSQSFWTHDSLLSSFYAS
SQGGEAFFKHLDSCLAHPESHLDLLELMYVCLSLGFIGQYRLEKNGLEAHRKLRKQVVSVLKLHGRGVQQ
ELSNKVEQHILTGAQVSERAPLWVVCSVTSALLVCIFMYFSYELNKASNQTFAQLVNLIQPTPAVSNPMV
ESKSAPIAERISMYLATEIGKDLVTVEALQDRVRISLRAQDLFESGSASVVAYIQPVISKVARTLEATQG
KIIITGHTDDRPIFTSKYPSNWHLSLARATSLSEQLIANSALKGRVIPEGLGDARPLVENDSEENRAMNR
RIEIDLIVGN
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|525852846|ref|NC_021822.1|:c1014452-1013160 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome II, complete sequence
ATGGAACAGACGATAGTAAAACCTACTCCTGGCGGAAGAGCGGCTGTATCTAAAGCTCAGCCTCAAAGAT
CAGCAGACAGTACTGTTGTGATATCCAAAAGCCCTGAGTTGGTTAACAACGATTCAGTTGTTGCTTATGG
AGATAATCCACTATTGGCAGAAGCTAATGGTCTACTTTCGATTATTGGACAAATCAGAGCAACAGCTACT
CATTCCGATCCTTTATTTCTTAAAGAAACGCTCGCGCAAAAACTTAGGGATTATGAGAATCGTCTGCGTC
AACATGATGTTGACCTGGAAACCATTGATACCGCACGTTATTGTCTGTGCTGTTCTTTAGACGAAGCAGT
ATTGAATACCAATTGGGGGAGTCAATCGTTTTGGACACATGATTCTCTGTTGAGCTCTTTTTACGCGAGC
AGCCAAGGTGGAGAGGCTTTTTTTAAGCATCTAGATAGCTGTTTGGCTCATCCGGAATCGCACTTAGATT
TACTAGAGCTAATGTACGTATGCTTATCTTTGGGTTTTATAGGCCAGTATCGTTTAGAAAAAAATGGGCT
TGAAGCTCACCGTAAATTGAGAAAACAAGTTGTATCAGTGCTTAAGTTACATGGTCGCGGAGTACAGCAA
GAGCTTAGTAACAAAGTAGAACAACATATATTGACAGGTGCTCAGGTTTCGGAACGTGCACCTCTGTGGG
TGGTTTGTTCGGTAACTTCCGCACTGCTTGTTTGTATTTTTATGTACTTCAGTTACGAGTTGAACAAAGC
TTCCAACCAAACTTTTGCTCAATTGGTAAACCTGATTCAACCAACCCCAGCGGTTAGTAATCCTATGGTT
GAGTCAAAGTCAGCACCTATTGCCGAAAGAATATCTATGTATTTAGCAACGGAAATTGGCAAGGATCTTG
TCACTGTGGAGGCGCTGCAAGATAGAGTTCGTATTTCTCTTAGAGCTCAAGACCTATTTGAATCTGGTAG
TGCGAGCGTTGTGGCTTACATACAGCCAGTTATTTCTAAAGTTGCACGTACCTTAGAAGCGACACAAGGG
AAGATCATAATTACCGGGCATACCGATGACCGTCCGATATTTACCAGCAAGTACCCATCCAATTGGCACT
TGTCTTTAGCTCGCGCAACTTCTCTTTCCGAACAGTTAATCGCCAACAGTGCACTTAAAGGTAGAGTGAT
TCCTGAAGGATTGGGTGATGCGAGACCTTTGGTAGAAAATGACAGTGAAGAGAACCGAGCAATGAATCGT
CGAATTGAAATCGATCTTATTGTGGGCAACTAA