SecReT6
Protein ID: 525856674
SecReT6 ID823
T6SS typei3
Gene symbol-
Locus tagCFSAN002050_07910
StrainSalmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
Repliconchromosome [GenBank: NC_021818] [Browse all T6SS(s) in this replicon]
Location [Strand]1326276..1326818 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDS5HIB2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.00E-60, Aligned region: 11..163
Protein Sequence: 180 a.a.     [Download]
>gi|525856674|ref|YP_008259517.1| type VI secretion protein [Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050]
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDRKFLDIDIDNF
NERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKA
GAENLVNKLLQDPTLLKTLANAPKPAATQQGVSADNESAE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|525855729|ref|NC_021818.1|:1326276-1326818 Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050, complete genome
ATGGCTATCAACAATAGCGCGCAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGCAGATTGAATATG
ACGTAGAGATTTACGGCTCTGAGAAAAAAATCGAGCTGCCGTTCGTGATGGCGGTGCTGGCCGATCTGGC
TGGGAAACCGCGTGAAGAACTGCCGCCGGTGACGGATCGCAAATTCCTCGATATTGATATTGATAACTTC
AATGAGCGCATGAAAGCCATTGCGCCGCGCGTGGCGTTCGCCGTGCCGAATACGCTGACGGGTGAAGGTC
AGTTGATGGTCGATATCACCCTGGAAAATATGGACGACTTTTCGCCGGCACAGATTGCCCGCAAGGTGGA
CGCCCTGAACCAGTTACTGGAAGCCCGCACTCAACTGGCGAACCTCCAGACCTACATGGATGGCAAGGCC
GGGGCGGAAAATCTGGTCAATAAACTGTTGCAGGACCCGACTCTGCTGAAAACGCTGGCGAATGCGCCGA
AACCGGCCGCTACCCAGCAAGGTGTGTCAGCGGATAATGAATCAGCGGAATAA