SecReT6
Protein ID: 525856675
SecReT6 ID823
T6SS typei3
Gene symbol-
Locus tagCFSAN002050_07915
StrainSalmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
Repliconchromosome [GenBank: NC_021818] [Browse all T6SS(s) in this replicon]
Location [Strand]1326842..1328350 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDS5HHI9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.50E-191, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|525856675|ref|YP_008259518.1| EvpB family type VI secretion protein [Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050]
MANSNMQATDAVAQDTVSASGEFDALLNQAFRPKTTQAAKAVEAAVQTLAQQALANTITVSDDAYKSISA
IIAQIDFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWD
QSPMFKKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQE
LANPRDLTKIVTQNLEYAPWNSLRASEDSRYIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYV
WSNAAYAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKN
GFIPLIHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKER
EDMQRWLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRL
VTKLPSVKQGNA
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|525855729|ref|NC_021818.1|:1326842-1328350 Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050, complete genome
ATGGCAAACAGTAATATGCAGGCAACCGACGCGGTTGCTCAGGATACCGTCTCCGCATCCGGTGAATTTG
ATGCGTTGCTGAATCAGGCCTTCCGACCCAAGACTACCCAGGCGGCAAAAGCCGTGGAAGCTGCGGTGCA
GACGCTGGCGCAACAGGCGCTGGCGAACACGATCACCGTCAGCGATGACGCCTATAAAAGCATCAGCGCT
ATTATTGCGCAGATCGACTTTAAGCTGACCGAACAGATCAAACTGATTCTGCAACATCCCGACTGGCAGA
AGCTGGAATCCTCGTGGCGCGGTATGGAGCATCTGGTTTACAACACCGAGACCGACGAAAAGCTGAAAAT
TCGCTTCATGAATCTGTCAAAAGATGAATTGCGGCGCAACATGAAGCGTTACAAGGGCATCGCCTGGGAT
CAAAGCCCGATGTTCAAGAAACTGTATGAAGCCGAATACGGCCAGTTAGGCGGCGAACCTTATGGCTGTA
TCATTGCGGATTACTACTTCGACCATACACCGCCCGATGTGGATCTGCTCGGCTCTATCGCCAAAGTCGC
CGCGTCGGCCCATGCGCCGTTTATTGCCGGGGCTTCCCCCTCGGTACTGCAAATGGACTCCTGGCAGGAG
CTGGCGAATCCCCGCGACCTGACCAAAATCGTCACCCAGAACCTGGAATATGCGCCGTGGAACTCGCTGC
GGGCCAGCGAAGACTCCCGTTATATTGGCCTGACGATGCCGCGTTTTCTTGCCCGCCTGCCGTATGGCGC
AAAAACCAACCCGGTGGACGAGTTTGATTTTGAAGAAGATGCGGATGGTTCTGACCATACCAAATACGTC
TGGAGCAACGCGGCCTACGCGATGGGCGTAAACATCAACCGTTCCTTCAAACACTACGGCTGGTGTACGT
TGATTCGCGGTGTGGAATCAGGCGGTGCGGTGGAAAATCTTCCCTGCCATACCTTCCCGACTGACGATGG
CGGCGTGGACATGAAATGCCCGACCGAAATCGCCATCTCTGACCGCCGCGAGGCTGAACTGGCGAAAAAC
GGTTTTATCCCGTTGATCCACCGTAAAAACTCAGACTATGCCGCCTTTATCGGCGCACAATCGCTGCAAA
AACCACAGGAATACTACGATCCGGACGCGACGGCCAACGCCAACCTGTCCGCCCGTCTGCCGTACCTGTT
CGCCTGCTCGCGCTTCGCTCACTTCCTCAAATGTATCGTCCGCGACAAAATCGGTTCCTTTAAAGAGCGT
GAGGATATGCAGCGCTGGCTAAATGAATGGATTATGAATTATGTCGACGCCGATCCGGTGAACTCCTCGC
AAGAAACCAAAGCCCGTCGTCCGCTGGCTGCCGCAGAGGTAGTGGTGGAAGAGGTGGAAGGCAATCCAGG
TTATTACGACGCGAAATTCTTCCTGCGTCCGCATTTCCAGCTTGAAGGGCTGACGGGATCGCTGCGCCTG
GTGACAAAACTGCCGTCAGTGAAGCAGGGCAATGCCTGA