SecReT6
Protein ID: 525856686
SecReT6 ID823
T6SS typei3
Gene symbol-
Locus tagCFSAN002050_07990
StrainSalmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
Repliconchromosome [GenBank: NC_021818] [Browse all T6SS(s) in this replicon]
Location [Strand]1344179..1346398 [+]
Producttype VI secretion protein Vgr
NoteTssI
UniProt IDS5HQQ2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-82, Aligned region: 142..434
Phage_base_V [PF04717], Evalue: 5.70E-26, Aligned region: 26..44
Phage_base_V [PF04717], Evalue: 5.70E-26, Aligned region: 472..564
DUF2345 [PF10106], Evalue: 4.10E-06, Aligned region: 69..90
DUF2345 [PF10106], Evalue: 4.10E-06, Aligned region: 601..616
DUF2345 [PF10106], Evalue: 4.10E-06, Aligned region: 675..733
Protein Sequence: 739 a.a.     [Download]
>gi|525856686|ref|YP_008259533.1| type VI secretion protein Vgr [Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050]
MSFVSTGNKSAGNGGPVITTPPITGESGDMSTGSVATGVADAAEQMAEQAAAELFGALPEPSGLVKAAVT
AAQAAAAAAGISDIVSAAQDTAASLAAGGPGAHNVTVSGSAVPPQMLLFAGINGSEKLGSLFTYIVQLKT
PDTLNLGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWVKLLT
HTSDYKAFQNKTVVDILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSE
DSHTLVLADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITASERLRTGQWVLDDFDFKKPRSRLANTVA
DPRETGHANYEHYEWPGDYFDKGEGEMLTRIRMEAQRSPGSRVHGAGNIRTLMTGYSFTLTNHPTAEVNQ
EYLLVQTTLFVRDNAQHSGQEQHFTYVSTFELHPTREVYRPQRTIDKPHTKGPQSAIVTGPSGQEIWTDQ
YGRVKVQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDT
MPPWGLPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHAEKDLNTTVKNNETHTVNADRTKTII
HNEITKVHIDRTEDVFGKHTETIKGNRNVKVTKGDQLLTVEKGIREVTVKTGTSTETVEKDISITSISGA
IHLTAKTQITLTVGKSSLTMNSDGTITLNGPTHLALNPQ
 
Nucleotide Sequence: 2220 bp     [Download]
>gi|525855729|ref|NC_021818.1|:1344179-1346398 Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050, complete genome
ATGAGTTTTGTATCTACGGGTAATAAATCAGCTGGAAATGGTGGACCCGTCATCACCACGCCGCCAATAA
CTGGCGAAAGTGGCGATATGAGCACAGGTTCAGTCGCAACCGGTGTTGCTGATGCAGCCGAACAGATGGC
AGAACAGGCAGCGGCGGAGCTGTTTGGTGCGCTGCCGGAGCCGTCAGGGCTGGTGAAAGCGGCAGTAACC
GCAGCGCAGGCCGCCGCAGCGGCGGCAGGGATATCGGATATAGTTAGTGCTGCCCAGGATACGGCGGCGT
CGCTTGCTGCCGGTGGGCCGGGAGCGCACAACGTCACGGTTAGCGGTAGCGCTGTGCCGCCGCAGATGCT
GCTTTTTGCTGGTATAAATGGTTCGGAGAAACTTGGCAGCTTGTTTACCTACATTGTACAGCTAAAAACG
CCCGACACCCTGAACCTGGGCTATGTCTCCCCGGCGGCCAACCTGCCGCTCAAACCGATGGTGGGCAAAG
ATCTGTGCGTCAACATCGAACTGGATGGTGGCGGTAAACGGCATATCAGCGGGCTGGTCACGGCGGCGCG
GGTGGTGGGCCATGAAGGGCGTTCGGTTACCTATGAGCTGCGTATGGAGCCGTGGGTAAAACTGCTGACC
CATACCAGCGACTACAAAGCATTCCAGAATAAAACCGTGGTGGATATTCTGGATGAGGTTCTGGCGGAAT
ATCCTTACCCGGTGGAAAAGCGACTGGTGGAAAGCTACCCGGTACGCACCTGGCAGGTGCAGTACGGTGA
AACTGATTTTGATTTTCTTCAGCGACTGATGCAGGAGTGGGGCATCTACTGGTGGTTTGAGCACAGCGAG
GACAGCCACACGCTGGTGCTGGCGGACGCCATCAGCGCCCACAAAGCATGTCCGGACTCGCCGCTGGTCG
AGTGGCACCAGGAAGGGCTGAAGCTGGATAAGGAGTTTATCCACACCATTACAGCCAGTGAGCGACTGCG
CACCGGACAGTGGGTGCTGGACGATTTTGACTTTAAAAAACCACGCTCGCGGCTGGCAAACACAGTGGCG
GACCCGCGCGAAACCGGTCACGCGAACTACGAGCACTACGAATGGCCGGGCGATTATTTTGACAAAGGCG
AGGGCGAGATGTTGACGCGCATCCGTATGGAAGCGCAGCGCAGCCCCGGCAGCCGGGTTCACGGTGCCGG
GAATATCCGCACCCTGATGACCGGATATTCGTTCACGCTGACGAACCACCCCACTGCCGAGGTCAACCAG
GAGTACCTGCTGGTTCAGACTACGCTGTTTGTGCGGGACAACGCGCAGCACAGCGGCCAGGAGCAGCACT
TCACCTACGTCAGCACGTTCGAACTGCATCCCACCCGCGAAGTCTACCGTCCACAGCGAACAATAGACAA
ACCGCACACTAAAGGCCCGCAGAGCGCCATTGTCACCGGCCCGTCGGGCCAGGAAATCTGGACGGATCAG
TACGGGCGGGTAAAGGTGCAGTTTGGCTGGGATCGTTACGGCAAAATGGATGAAAACAGCTCCTGCTGGA
TACGCGTCAGCTACCCATGGGCGGGCAAAGGCTTCGGGATGATCCAGATCCCGCGTATCGGCCAGGAAGT
GCTGGTGGATTTCAAAAACGGCGATCCGGATCTGCCGATCATCGTGGGGCGTACCTACAACCAGGACACC
ATGCCGCCGTGGGGACTGCCGGGAATGGCGTCGCAGAGCGGGATATTCAGTCACTCACTATATGGCGGGC
CAACGAACGGCAACATGCTGCGTTTTGATGATAAAACGGGCGCGGAGGAAGTGAAGTTCCACGCGGAAAA
AGATCTCAACACCACGGTGAAGAATAATGAAACGCATACGGTAAATGCTGACCGGACAAAGACCATTATC
CATAACGAAATTACAAAAGTGCATATTGATCGCACGGAAGATGTTTTTGGTAAGCATACTGAGACGATTA
AGGGAAACCGCAATGTCAAGGTGACGAAAGGGGATCAGCTCCTGACTGTGGAGAAAGGGATACGGGAGGT
AACGGTAAAAACTGGCACCAGTACTGAAACGGTTGAAAAAGATATCTCTATTACATCCATTTCCGGGGCT
ATTCATTTGACGGCAAAAACACAGATTACGCTAACCGTAGGTAAAAGCTCACTCACCATGAATTCAGACG
GCACTATCACATTGAACGGCCCCACCCATCTGGCACTCAATCCACAGTAA