SecReT6
Protein ID: 525856687
SecReT6 ID823
T6SS typei3
Gene symbol-
Locus tagCFSAN002050_08035
StrainSalmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
Repliconchromosome [GenBank: NC_021818] [Browse all T6SS(s) in this replicon]
Location [Strand]1354756..1356990 [+]
Producttype VI secretion protein Vgr
NoteTssI
UniProt IDS5HEC6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.60E-79, Aligned region: 121..429
Phage_GPD [PF05954], Evalue: 1.60E-79, Aligned region: 633..647
Phage_base_V [PF04717], Evalue: 9.10E-26, Aligned region: 467..559
Protein Sequence: 744 a.a.     [Download]
>gi|525856687|ref|YP_008259542.1| type VI secretion protein Vgr [Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050]
MSFVSTNNKSDMGGLTTTTPPITGESGGVTADSVAGSVADAAEAAVEQAAGSLFGALPEPSGLVKAAVAA
AQAAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGGETLSELFSYVVQLKTPDTLN
LGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWVKLLTHTSDY
KAFQNKTVVDILDEVLAEYPYPVEKRLVESYPVRAWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTL
VLADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRET
GHATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLM
QTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQEIWTDQYGRVK
VQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWG
LPGAATQSGIYSHTIGGGPTNANALRFEDKPGSEEVWLHAEKDQRIEVNNNESHWVGNNRVKVIDQSEIA
TIGAVRDHKVQYDDTSLAGGNKTIQTVKELYLAAGDSITLSCGDTVLYMSSKGEFYVTCKTFNITATDAD
GQINTIKGQLDLNMDKREPKVGTFGESEKTAMAAVIKETFPPKE
 
Nucleotide Sequence: 2235 bp     [Download]
>gi|525855729|ref|NC_021818.1|:1354756-1356990 Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050, complete genome
ATGAGTTTTGTATCCACAAATAATAAATCCGATATGGGAGGGCTGACGACAACCACGCCGCCGATAACCG
GAGAAAGTGGCGGTGTCACCGCAGATTCAGTCGCCGGAAGCGTGGCAGATGCGGCGGAAGCCGCCGTGGA
ACAGGCTGCGGGATCGCTGTTTGGCGCATTGCCGGAGCCATCAGGACTGGTGAAAGCCGCGGTGGCAGCG
GCGCAGGCCGCCGCCGCCGCAGGTATGGCGCAGGATGCGGTATCGGCCATCGTCTCCGCTGTTGCAGGCG
GGCCGGGGGCGCATAATGTGACGGTCAGCGGCAGCGCCGTACCGCCGGGCGCATTACTGTTCGCCAGCCT
GGACGGCGGCGAAACATTAAGTGAACTGTTCAGCTATGTGGTACAGCTAAAAACGCCCGACACCCTGAAT
CTGGGCTATGTCTCCCCGGCGGCCAATCTGCCGCTCAAACCGATGGTGGGCAAAGATCTGTGCGTCAACA
TCGAACTGGATGGTGGCGGTAAACGACATATCAGCGGGCTGGTCACGGCGGCGCGGGTGGTGGGCCATGA
AGGGCGTTCGGTTACCTATGAGCTGCGTATGGAGCCGTGGGTAAAACTGCTGACCCACACCAGCGACTAC
AAAGCATTCCAGAATAAAACCGTGGTGGATATTCTGGATGAGGTTCTGGCGGAATACCCCTACCCGGTGG
AAAAGCGGCTGGTGGAAAGCTACCCGGTACGCGCCTGGCAGGTGCAGTACGGTGAAACTGATTTTGATTT
TCTTCAGCGACTGATGCAGGAGTGGGGCATCTACTGGTGGTTTGAGCACAGCGAGGACAGCCACACGCTG
GTGCTGGCGGATGCCATCAGCGCCCACAAAGCATGTCCGGACTCGCCGCTGGTCGAGTGGCACCAGGAAG
GGCTGAAGCTGGACAAGGAGTTTATCCACACTATCACGGCAAACGAGAGTCTGCGGACTGGCCAGTGGGT
GCTGGATGATTTCGATTTTACGAAGCCACGTTCATTGCTGGCAAACACGGTGGCAAACCCGCGTGAAACC
GGTCATGCCACCTACGAGCATTATGAGTGGCCGGGAGACTACTTCGACAAGAGTGAAGGCGAGATGCTGA
CGCGCATTCGTATGGAAGCGCAGCGCAGCCCCGGCAGTCGGGTGCTGGGGGGAGGGAATATCCGCACACT
CATGACCGGTTATACCTTCACGCTGGAAAACTATCCCACTGCCGAAGTCAATCAGGAATACCTGCTGATG
CAGACCTTGCTGTTTGTGCAGGACAACGCGCAGCACAGCGGGCAGGACCAGCACTTTACCTTTTCCACCC
GTTTTGAACTGCACCCGACCCGTGAGGTGTTCCGCCCGCAGCGGACGGTGAGCAAACCCCACACCAAAGG
GCCGCAGAGCGCCATCGTCACCGGCCCGGCGGGCCAGGAAATCTGGACGGATCAGTACGGGCGGGTAAAG
GTACAGTTTGGCTGGGATCGCTACGGCAAAATGGATGAAAACAGCTCCTGCTGGATACGCGTCAGCTACC
CGTGGGCGGGCAAAGGCTTCGGGATGATCCAGATCCCGCGTATCGGCCAGGAAGTGCTGGTGGATTTCAA
AAACGGCGATCCGGATCTGCCGATCATCGTGGGGCGTACCTACAACCAGGACACCATGCCACCGTGGGGA
CTGCCGGGCGCGGCAACACAGAGCGGGATATACAGCCACACTATCGGCGGCGGACCGACCAATGCCAACG
CCCTGCGTTTTGAAGATAAACCCGGTAGTGAAGAGGTCTGGCTACATGCTGAAAAAGATCAGCGTATTGA
AGTTAATAATAATGAAAGTCACTGGGTGGGGAATAATCGGGTTAAGGTCATTGATCAGTCAGAAATAGCC
ACTATTGGCGCTGTCCGCGATCATAAAGTTCAGTATGACGATACCTCTCTGGCCGGAGGAAATAAAACCA
TTCAGACGGTAAAAGAGTTATATCTGGCAGCGGGTGATTCTATTACCCTGAGTTGTGGTGACACCGTTCT
GTACATGAGCAGTAAGGGGGAATTTTACGTAACCTGTAAAACGTTCAATATTACTGCAACAGATGCCGAT
GGTCAGATTAATACTATAAAAGGGCAGCTGGATTTAAATATGGATAAAAGAGAACCCAAAGTGGGAACAT
TTGGTGAGTCAGAAAAAACAGCAATGGCAGCAGTAATTAAGGAAACTTTTCCACCCAAAGAATAG