SecReT6
Protein ID: 526219205
SecReT6 ID824
T6SS typei3
Gene symbol-
Locus tagSE451236_07370
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. 08-1736
Repliconchromosome [GenBank: NC_021820] [Browse all T6SS(s) in this replicon]
Location [Strand]1597547..1598371 [-]
Producthypothetical protein
NoteTagJ
UniProt IDS5ICD5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.10E-46, Aligned region: 143..266
Protein Sequence: 274 a.a.     [Download]
>gi|526219205|ref|YP_008264523.1| hypothetical protein SE451236_07370 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736]
MKKTDTLPATLSALIQEYSIAEGIQMAEQQVRENPAKALCRHSLFQLLCVAGDWSRALHQLQLCARMEAN
YTQEARLYRELVRCEMFRHTVFQGEQRPGFLLPQPVWVESLLAALACHDDTGEVDKHRNTALEAITDTGG
QWNGGAFDWASDSDSRLGPVLELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWL
FTRYSGSESASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMAHCTFHAQENDGA
 
Nucleotide Sequence: 825 bp     [Download]
>gi|526218030|ref|NC_021820.1|:c1598371-1597547 Salmonella enterica subsp. enterica serovar Typhimurium str. 08-1736, complete genome
ATGAAAAAAACTGACACGCTTCCTGCTACCCTGTCCGCGCTGATACAGGAATACTCTATTGCGGAGGGGA
TTCAGATGGCGGAGCAGCAGGTTCGGGAAAATCCGGCGAAAGCGCTCTGCCGCCACAGCCTGTTTCAGTT
GCTGTGTGTGGCCGGAGACTGGTCGCGGGCGCTACACCAGCTTCAGCTATGCGCCAGGATGGAGGCCAAT
TATACCCAGGAGGCCCGGCTGTACCGGGAGCTGGTTCGCTGCGAAATGTTCCGCCACACCGTTTTTCAGG
GTGAACAACGACCCGGTTTTCTTCTGCCGCAGCCCGTTTGGGTGGAGTCACTGCTGGCGGCACTCGCCTG
TCATGACGATACCGGTGAGGTTGATAAACACCGTAATACCGCACTGGAAGCCATAACAGACACGGGCGGG
CAGTGGAACGGCGGCGCATTTGACTGGGCGAGCGACAGCGATTCCCGCCTTGGCCCGGTACTTGAGCTAG
TCACCGGCGGCGTGTATATCTGGCTGCCGTTTTCGCAAATACGCTCGCTGGAATCGCCGCAACCGACGCG
CCTGACTGATCTGCTGTGGAAACCCGTTAATATCACCCTGGTGAATGGCGATACGCACGGCGCCTGGCTC
TTTACCCGTTACAGCGGTTCGGAAAGTGCATCCGACGCCCTGCGTCTGTGCAGGGAAACCGCCTGGCAGG
ACGGCCCCGGCGAAACCACCGTGCGGGCGCTGGGGCAGAAAGTGTGGCTGACCAGCCACGGCGATATCAG
CCTGCTGGACATGGCCCATTGTACCTTTCATGCTCAGGAAAACGATGGCGCATGA