SecReT6
Protein ID: 526456866
SecReT6 ID832
T6SS typei3
Gene symbol-
Locus tagBDL_5941
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3037775..3040528 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDS5NX41
KEGG IDbpse:BDL_5941
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.40E-78, Aligned region: 41..368
Phage_GPD [PF05954], Evalue: 6.40E-78, Aligned region: 769..859
Phage_base_V [PF04717], Evalue: 8.90E-25, Aligned region: 408..501
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 552..572
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 585..601
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 593..614
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 613..630
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 618..637
Protein Sequence: 917 a.a.     [Download]
>gi|526456866|ref|YP_008329704.1| Rhs element Vgr family protein [Burkholderia pseudomallei MSHR305]
MPNHFSNGRTNQSRTVVIRSGAMPRLLGQPALEFLSLRGEEHLGKLYTYELLLRTPDDFHVPLATSANLD
LKAMIGTEMTVCIQLDGIGTGAQGGVGAGAREISGLVVKAGFLRCEGRYNVYRIELRPWLWLATLTSDYK
IFQDKSVVEIIDTVLHDYPYPVEKRLDIDKYSVAGESARNEPRAFQVQYGETDFDFVQRLMEEWGIYWFF
EHSDNKHRLVLCDHIGGHRKAPSEAYHEIAHHPEGGKIDIEYINYFSTDEALRPGRVVIDDFDFTRPLAS
LVTSNHQPRETNWGEGELFEWPGDYTDSKHGDLISRVRMEERRATGSRAYGRGNVRGLACGHTFVLSKHK
HDGANREYLVIESALMLTEVADETGSGYRYECDNELVVQPSNEVFRMPRETPKPTTSGPQSAIVVGPPGH
EVWTDEFGRVKIRFLWDRYARNDATDSCWVRVSQAWAGVNFGGIYIPRIGQEVIVGFMNGDPDRPLILGS
LYNTITPPPWDLPGDATKSGFKSKSITGGRENYNGIRFEDKLGAEEFHMQAEKDMNRLTKNDESHTVGAN
FSIGVGLTHTRAVGAMFSSIVGGAASYAVGGAESTMIGGAYALNVGGAHAVAVGGASSVSVGGAYARNVG
GAYALTVGGVLSIVCGASSITMTACGSIKIVGKNIRIIGSDEVVVQGAPLQLNPGDSDCGGGGGGGGGGG
AIPPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPRRRATRPRPRPRR
RPTPTPTPTPTPRQRQRQRQRRRPRRRPRPRQRQRRRRRQRRRRRPRRRRRRRRRPRRRRRRRRRPRPRQ
RQRRRQRRRRRRRQRRRQRQRQRRLVPRFKQCPLAPCKAPTFRGSPSHSSESFEHDNPGSKSGRCDRTWR
RSRHRLR
 
Nucleotide Sequence: 2754 bp     [Download]
>gi|526456747|ref|NC_021877.1|:3037775-3040528 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGCCAAACCATTTTTCGAACGGACGGACGAATCAAAGCCGCACGGTAGTGATCCGCAGCGGTGCGATGC
CGCGGCTGCTCGGTCAGCCCGCGCTCGAGTTCCTGTCGCTGCGCGGTGAAGAGCACCTCGGAAAACTCTA
CACGTACGAATTGCTCCTGCGCACGCCGGACGATTTTCATGTGCCGTTGGCAACGAGCGCGAATCTCGAC
CTGAAGGCGATGATCGGCACGGAGATGACGGTCTGCATTCAGCTCGACGGAATCGGGACGGGCGCGCAAG
GCGGCGTTGGCGCGGGTGCGCGCGAAATCAGCGGGCTCGTGGTCAAGGCGGGCTTCCTGCGCTGCGAGGG
GCGCTACAACGTCTATCGCATCGAGCTGCGCCCCTGGCTGTGGCTCGCGACTCTGACGAGCGACTACAAG
ATTTTTCAGGACAAGAGCGTCGTCGAAATCATCGATACGGTCTTGCACGATTACCCTTACCCGGTCGAGA
AGCGGCTCGACATCGACAAGTATTCGGTGGCGGGCGAGAGCGCTCGAAACGAGCCGCGCGCGTTCCAGGT
GCAATATGGCGAAACCGACTTCGACTTCGTTCAGCGTTTGATGGAGGAGTGGGGGATCTACTGGTTCTTC
GAGCATTCGGACAACAAGCATCGCCTGGTCTTGTGCGATCACATCGGCGGACATCGCAAGGCGCCGAGCG
AGGCCTATCACGAGATCGCGCATCACCCGGAAGGCGGGAAGATCGACATCGAGTACATCAACTATTTCTC
GACGGACGAAGCGCTGCGGCCCGGCCGCGTCGTGATAGACGATTTCGACTTCACGCGTCCGCTCGCGAGC
CTCGTCACGTCCAATCACCAGCCGCGGGAGACGAACTGGGGGGAGGGCGAGCTGTTCGAATGGCCGGGCG
ACTATACCGATAGCAAGCATGGCGATCTCATCAGCCGCGTGCGCATGGAAGAGCGCCGCGCGACCGGGTC
GCGCGCGTACGGTCGGGGCAACGTGCGCGGCCTCGCCTGCGGTCATACGTTCGTGCTGTCGAAGCACAAG
CACGACGGCGCGAACCGCGAGTACCTCGTCATCGAATCGGCGTTGATGCTGACCGAAGTCGCGGACGAAA
CGGGCAGCGGCTACCGCTACGAATGCGATAACGAACTGGTCGTGCAGCCGTCGAACGAGGTGTTTCGAAT
GCCGCGCGAAACGCCCAAGCCGACGACGAGCGGGCCACAGTCCGCGATCGTGGTCGGGCCGCCGGGCCAC
GAGGTATGGACCGACGAATTCGGCCGCGTGAAGATCCGTTTTCTGTGGGATCGCTACGCACGCAATGATG
CAACGGATTCCTGCTGGGTACGCGTGAGCCAGGCGTGGGCCGGCGTGAACTTCGGCGGCATCTACATTCC
GCGGATCGGACAGGAAGTGATCGTCGGATTCATGAACGGCGATCCGGACCGTCCGCTGATTCTCGGCAGC
CTCTACAACACCATTACGCCGCCGCCTTGGGATCTGCCCGGCGACGCGACGAAGAGCGGATTCAAGAGCA
AGTCGATCACGGGCGGGCGCGAGAACTATAACGGCATCCGCTTCGAGGACAAGCTGGGGGCCGAGGAATT
TCACATGCAGGCGGAAAAGGACATGAACCGCCTGACGAAGAACGACGAGTCGCATACGGTCGGCGCGAAT
TTTTCGATCGGCGTCGGGCTTACCCATACGCGCGCGGTGGGCGCCATGTTCAGCAGCATCGTCGGCGGAG
CCGCCAGCTATGCGGTGGGGGGCGCGGAATCGACGATGATCGGTGGCGCGTATGCGTTGAACGTCGGCGG
CGCGCACGCGGTTGCGGTGGGCGGCGCGTCGTCCGTTTCCGTTGGCGGCGCCTACGCGCGCAACGTGGGC
GGCGCGTATGCGCTGACAGTCGGCGGCGTGCTGTCGATCGTCTGCGGTGCGTCTTCGATCACCATGACGG
CTTGCGGCTCGATCAAGATCGTCGGCAAGAATATTCGCATCATCGGCAGCGACGAAGTCGTCGTGCAAGG
CGCGCCCCTGCAGCTGAATCCGGGCGATTCGGATTGCGGCGGAGGGGGAGGCGGCGGCGGCGGCGGCGGC
GCGATTCCGCCGATTCCGTTGCCGTCGTTCTTCCTCGATATCACGAAGCCGATTCTTCCGCCGCCGCCGC
CGCCACCGACGGAGGTGCCACCGGATCCGACGCCCACGCCGACGCCCACGCCGACGCCGACGCCGACGCC
CACGCCCACGCCGACGCCAACGCCGACCCCACGCCGACGCGCCACGCGCCCACGCCCACGCCCACGCCGA
CGCCCCACGCCCACGCCAACGCCCACGCCGACCCCACGCCAACGCCAACGCCAACGCCAACGCCGACGCC
CACGCCGACGCCCACGCCCACGCCAACGCCAACGCCGACGCCGACGCCAACGCCGACGCCGACGCCCACG
CCGACGCCGACGCCGACGCCGACGCCCACGCCGACGCCGACGCCGACGCCGACGCCCACGCCCACGCCAA
CGCCAACGCCGACGCCAACGCCGACGCCGACGCCGACGCCAACGCCGACGCCAACGCCAACGCCAACGCC
GACTAGTTCCGAGATTTAAGCAATGCCCACTGGCGCCATGTAAGGCGCCAACATTCAGAGGTTCACCAAG
TCATTCATCGGAGAGTTTTGAACATGACAATCCCGGCAGCAAGAGTGGGAGATGCGATCGGACATGGCGG
CGTTCTCGTCACCGGCTCAGGTGA