SecReT6
Protein ID: 526456945
SecReT6 ID829
T6SS typei3
Gene symbol-
Locus tagBDL_3742
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]266566..267504 [+]
Producthypothetical protein
NoteTssA
UniProt IDS5NJI9
KEGG IDbpse:BDL_3742
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-16, Aligned region: 46..104
Protein Sequence: 312 a.a.     [Download]
>gi|526456945|ref|YP_008327528.1| hypothetical protein BDL_3742 [Burkholderia pseudomallei MSHR305]
MNNDALPGHSPDLLDFDEDFIKIDAAICEYDSVGYAPQRKGESAFQWASIETGCLALLKKAKDVRVGIWH
LRACIARRGLSGLADGVRSLADLMSAPVEELHPRALPDESPGETLLIHLGWLAGPQFLHQLGSSRFEDRD
ATLNDLIGGRAAAIVEDRDYRLRANTLVHDIQDSLSRIRESIAAAEQELNVSRALDLLSVAASRLTQAQA
GGADGASVESDAPVDAPAGASAPGAQQPMAGPGGVLRSRQEVGAALDRIVEYFRVHEPSHPAPIFLSRIQ
RMLGAGFEEVMAELYPEAASLVAQLSRPQSSK
 
Nucleotide Sequence: 939 bp     [Download]
>gi|526456747|ref|NC_021877.1|:266566-267504 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGAACAACGATGCACTCCCGGGCCATTCGCCGGATTTGCTGGATTTCGACGAAGACTTTATCAAGATCG
ACGCAGCCATCTGCGAATACGATTCCGTCGGTTACGCGCCGCAACGCAAAGGAGAGAGTGCGTTCCAGTG
GGCGTCCATCGAAACGGGATGCCTCGCTTTGTTGAAGAAGGCAAAGGATGTCCGGGTCGGCATTTGGCAT
CTGCGCGCATGCATCGCGCGGCGCGGGCTGAGCGGGCTGGCAGACGGCGTTCGATCGCTGGCCGATCTGA
TGAGTGCGCCCGTCGAGGAATTGCATCCTCGCGCGCTGCCTGACGAATCGCCCGGCGAAACCCTCCTGAT
TCATCTCGGCTGGCTTGCGGGCCCGCAGTTCCTGCATCAGCTCGGCAGTTCCCGGTTCGAAGATCGGGAC
GCAACCCTCAACGATCTGATCGGCGGGCGCGCCGCGGCGATCGTGGAGGATCGCGACTATCGCCTTAGAG
CGAATACTCTTGTACATGACATTCAGGATTCCTTATCGCGAATTCGGGAATCGATCGCCGCGGCCGAGCA
AGAGCTCAACGTCTCGCGCGCGCTCGACCTGTTGAGCGTCGCGGCGTCTCGGCTCACGCAGGCGCAAGCC
GGCGGCGCGGACGGCGCAAGCGTCGAGAGCGACGCGCCGGTCGATGCGCCGGCCGGCGCGTCCGCGCCCG
GCGCGCAGCAGCCGATGGCGGGGCCGGGCGGCGTGTTGAGGTCGAGACAGGAGGTCGGCGCGGCGCTCGA
TCGGATCGTGGAGTACTTCCGCGTGCACGAGCCGAGCCATCCGGCGCCGATCTTCCTGTCGCGGATTCAA
CGAATGCTGGGGGCGGGTTTCGAGGAAGTGATGGCGGAGCTCTATCCCGAGGCGGCATCTCTCGTGGCCC
AACTGAGCCGGCCGCAGAGTTCCAAGTAA