SecReT6
Protein ID: 526456964
SecReT6 ID832
T6SS typei3
Gene symbol-
Locus tagBDL_5946
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3046559..3047629 [-]
Producthypothetical protein
NoteTssA
UniProt IDS5NIY0
KEGG IDbpse:BDL_5946
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.80E-22, Aligned region: 61..120
ImpA-rel_N [PF06812], Evalue: 8.80E-22, Aligned region: 184..193
Protein Sequence: 356 a.a.     [Download]
>gi|526456964|ref|YP_008329709.1| hypothetical protein BDL_5946 [Burkholderia pseudomallei MSHR305]
MNATPPAAALRYADLLEPVSPDAPCGPDLEYDPAFVMLQSAIAPRKDAQYGEFVEAPQPANWAEAERDCL
ALLLRTKDIRLVVILMRCRIRQSGAEGLRDGLALLNELLARYGEALHPVPFFEGERDPVVYANAIATLAD
PDATLADIREIPLPKASGLQLQLRDIEKALAVTRVKDALAPESASRLLKEWWNRRDKTIAALAQAQRIVA
DLIASTRESLGDDAPDLSGIAKLLHPFAQAQLESPYSANAAQPQGDAKPATGDAAHARAADTSTQAGDTD
TQAPAAMPIAPAQPPMDRWGALAAIQATRLWFEQNEPSSPVIVLLRQSERMVGKRFSEIANAIPAELLAQ
WDAIDV
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c3047629-3046559 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGAATGCCACCCCACCCGCCGCCGCGCTGCGCTATGCGGATCTTCTCGAGCCCGTCTCGCCGGACGCAC
CCTGCGGGCCGGACCTCGAATACGATCCGGCGTTCGTGATGCTGCAATCCGCGATCGCGCCGAGGAAAGA
TGCGCAATATGGCGAGTTCGTCGAAGCGCCTCAGCCCGCGAACTGGGCGGAGGCCGAACGCGATTGCCTC
GCGCTGCTGCTGCGCACGAAAGACATCCGGCTCGTCGTGATCCTGATGCGATGCCGAATCCGCCAGAGCG
GCGCGGAGGGCCTGCGCGACGGCCTCGCGCTGCTCAACGAGTTGCTCGCGCGCTACGGTGAGGCGCTGCA
CCCCGTACCGTTCTTCGAAGGCGAACGCGATCCCGTGGTCTATGCGAATGCGATCGCCACGCTGGCGGAC
CCCGATGCGACGCTCGCGGATATTCGGGAAATCCCGTTGCCCAAGGCGAGCGGCCTGCAATTGCAGTTGC
GCGACATCGAAAAGGCGCTCGCGGTGACGCGCGTGAAAGACGCACTCGCGCCCGAATCGGCCAGCCGGCT
GCTGAAGGAATGGTGGAATCGGCGCGACAAGACGATCGCGGCGCTCGCGCAAGCCCAGCGCATCGTGGCC
GATCTGATCGCGTCGACCCGCGAGTCGCTCGGCGACGACGCGCCCGACCTGTCGGGCATCGCGAAACTGC
TGCATCCGTTTGCGCAAGCGCAACTGGAATCGCCGTATTCGGCAAACGCCGCTCAACCGCAAGGCGACGC
GAAGCCGGCGACCGGCGACGCCGCGCATGCGCGCGCCGCCGATACGTCCACCCAGGCAGGCGATACCGAC
ACGCAAGCGCCCGCTGCGATGCCGATCGCGCCTGCCCAACCGCCGATGGATCGCTGGGGCGCGCTGGCGG
CCATTCAGGCGACGCGCCTTTGGTTCGAGCAGAACGAGCCGAGCAGCCCGGTGATCGTGCTGCTGCGCCA
GTCGGAGCGGATGGTCGGCAAGCGCTTTTCGGAAATCGCCAATGCGATTCCCGCCGAACTGCTCGCGCAA
TGGGATGCGATCGACGTCTAG