SecReT6
Protein ID: 526457079
SecReT6 ID833
T6SS typei3
Gene symbol-
Locus tagBDL_6063
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3186956..3188455 [-]
Producthypothetical protein
NoteTssC
UniProt IDS5NJ91
KEGG IDbpse:BDL_6063
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-191, Aligned region: 67..493
Protein Sequence: 499 a.a.     [Download]
>gi|526457079|ref|YP_008329826.1| hypothetical protein BDL_6063 [Burkholderia pseudomallei MSHR305]
MKKQQAQTAAAGVQPQADSDFAQLLAQEFKPKTEQAREAVEYAVRTLAEQALAQSATISDDAYKSIAAII
AQIDHKLSEQINLILHHADFQKLESAWRGLHHLVSNTETDERLKIRFMDISKEELRRTMRRYKGQSWDQS
PLFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLGSISKVAASAHTPFLSGASPSVLQMESWQELA
NPRDLTKIFTQNLEYASWNALRNMDDARYIGLAMPRFLSRLPYGVLTNPVDEFDFEEDTNGADHRRYAWT
NAAYAMGVNINRSFRLYGWCSLIRGVESGGTVENLPCHTFPTDDGGIDIKCPTEIAISDRREAELSKNGF
IPLVHRKNTDHATFIGAQSLHKPAEYDDSDATANANLSARLPYLFACSRFAHYLKCIVRDKVGAFKERED
MQRWLNEWIMNYVDADPANSSQDTKARRPLAAAEVVVEQAQGNPGYYQAKFFLRPHFQLEGLTVSLRLVA
KLPSIKEAA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c3188455-3186956 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGAAGAAACAGCAAGCCCAGACGGCCGCCGCCGGCGTCCAGCCGCAAGCGGATTCGGATTTCGCGCAGT
TGCTCGCGCAGGAGTTCAAGCCGAAGACGGAGCAGGCGCGCGAAGCGGTCGAATACGCGGTGCGCACGCT
CGCCGAGCAGGCGCTCGCGCAATCGGCGACGATCAGCGACGATGCATACAAGAGCATCGCCGCGATCATC
GCGCAGATCGACCATAAGCTATCCGAACAGATCAACCTGATCCTCCATCACGCGGATTTCCAGAAGCTCG
AATCGGCGTGGCGCGGGCTGCATCACCTGGTGTCGAACACCGAGACCGACGAGCGCCTGAAGATCCGCTT
TATGGACATCTCGAAGGAAGAGCTGCGCCGCACGATGCGGCGCTACAAGGGGCAATCGTGGGACCAGAGC
CCGCTCTTCAAGCAGATCTACGAGGAGGAGTACGGGCAGCTCGGCGGCGAGCCGTACGGCTGCCTCGTCG
CCGATTACTACTTCGACCACACGCCGCCCGACGTCGACCTGCTCGGCTCGATCTCGAAGGTGGCCGCGTC
CGCGCACACGCCGTTCCTCTCCGGCGCGTCGCCTTCGGTGCTGCAGATGGAATCGTGGCAGGAGCTCGCG
AACCCGCGCGACCTGACGAAGATCTTCACGCAAAACCTCGAATACGCGTCATGGAACGCGCTGCGCAACA
TGGACGACGCGCGCTACATCGGCCTCGCGATGCCGCGCTTCCTGTCGCGCCTGCCGTACGGCGTGCTGAC
GAATCCCGTCGACGAGTTCGACTTCGAGGAAGACACGAACGGCGCCGACCATCGCCGCTACGCGTGGACG
AACGCCGCCTACGCGATGGGCGTGAACATCAACCGGTCGTTCCGGCTCTACGGCTGGTGCTCGCTCATTC
GCGGCGTCGAATCGGGCGGCACCGTCGAGAACCTGCCGTGCCATACGTTCCCGACCGACGACGGCGGCAT
CGACATCAAATGCCCAACCGAGATCGCGATCTCGGACCGGCGCGAGGCGGAGCTGTCGAAGAACGGCTTC
ATTCCGCTCGTGCACCGCAAGAACACCGATCACGCGACGTTCATCGGCGCGCAATCGCTGCACAAGCCGG
CCGAATACGACGATTCCGACGCGACGGCCAACGCGAATCTGTCGGCGCGCCTGCCGTATCTGTTCGCATG
CTCGCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGGTGGGCGCCTTCAAGGAGCGCGAGGAC
ATGCAGCGCTGGCTGAACGAATGGATCATGAACTACGTCGACGCGGACCCGGCGAACTCGTCGCAGGACA
CGAAGGCGCGCCGGCCGCTCGCGGCCGCCGAGGTGGTCGTCGAGCAGGCGCAAGGCAACCCCGGCTACTA
CCAGGCGAAGTTCTTCCTGCGGCCGCATTTCCAGCTCGAGGGCCTGACCGTGTCGCTGCGGCTCGTCGCG
AAGCTGCCGTCGATCAAGGAAGCCGCCTGA