SecReT6
Protein ID: 526457093
SecReT6 ID830
T6SS typei1
Gene symbol-
Locus tagBDL_4807
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]1649038..1650882 [-]
Producthistidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein
NoteVirA
UniProt IDS5P402
KEGG IDbpse:BDL_4807
PDB IDNA
Domain hit(s) vs Pfam HATPase_c [PF02518], Evalue: 3.80E-21, Aligned region: 454..592
MASE1 [PF05231], Evalue: 8.10E-16, Aligned region: 62..323
HisKA [PF00512], Evalue: 0.00055, Aligned region: 311..338
HisKA [PF00512], Evalue: 0.00055, Aligned region: 337..402
Protein Sequence: 614 a.a.     [Download]
>gi|526457093|ref|YP_008328584.1| histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein [Burkholderia pseudomallei MSHR305]
MHGNSIDAGPPARARPARITRAARAAPRRADRAFAPGGALNAAGLLLLLFYANHLLSRPGACTSLNHTLS
AVVWPAPVLGIALLLHCRRPLAWWLGAGALFATLLAAGSLDWVPWHVDALFAAVNVVEAIAGAWLARRYL
IAGGGVDTLRGFAMFVLLLPLGMAAMHATLAAAILSVWMNDREWLSEWSRAYAANALALLVLLPALLTWN
ARACGATWSRSRNQLPVLATFGSLCFASIWGYQAEVARALLALSLSWAALEGGLVLASQLNALSAIALIA
MTLGGRGPYAWHHDGHGVWALQVDLIGVAILSMCIAIATGERRRLARQIERSRRFESLGFFAGGIVHDFS
NVLTTIDCHAEYASERLASGARADDSIDEIHRAVERGRDLAAQILLAARRGEPVLTRVSVDEVVDEALAA
TRAAAWRGVEIVRCGDGARDGARRGDVRHVVFADRSQLARAVMNLVGNAVRAARATVVVRVGVNGGVNGG
ASDGASRGANDGGAPAARAFDVAIGEASMPGGVWIEVSDDGEGIDVEPLDRIFEPFYSNRSGAPGTGLGL
AIVAGAALAHRGQIAVATDRGVGSCFRFTLPAAWGTGAPGAMDAGGPSAVQERQ
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c1650882-1649038 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGCACGGAAATTCCATCGATGCCGGGCCGCCCGCGCGCGCCCGGCCCGCACGCATCACGCGAGCGGCGC
GCGCCGCGCCGCGCCGCGCCGATCGCGCGTTCGCGCCGGGCGGCGCGCTGAACGCGGCGGGGCTGCTGCT
GCTGCTGTTCTACGCGAATCATCTGCTGTCCCGGCCCGGCGCGTGCACGTCGCTCAATCACACGCTGTCG
GCCGTCGTGTGGCCCGCGCCGGTGCTCGGCATCGCGCTGCTGCTGCACTGCCGGCGGCCGCTCGCATGGT
GGCTCGGCGCGGGTGCGCTGTTCGCCACGCTGCTCGCCGCGGGCTCGCTCGACTGGGTGCCGTGGCACGT
CGACGCGCTGTTCGCGGCCGTCAACGTCGTCGAGGCGATCGCGGGCGCGTGGCTCGCGCGGCGTTATCTG
ATCGCGGGCGGCGGGGTGGACACGCTGCGCGGCTTCGCGATGTTCGTGCTGCTGCTGCCGCTCGGCATGG
CGGCGATGCACGCGACGCTCGCGGCGGCGATCCTGTCGGTGTGGATGAACGACCGCGAATGGCTGAGCGA
ATGGTCGCGCGCGTATGCGGCGAACGCGCTCGCGCTGCTCGTGCTGCTGCCGGCGCTCCTCACGTGGAAC
GCGCGCGCGTGCGGCGCGACGTGGTCGCGCAGCCGCAATCAGTTGCCGGTGCTCGCGACGTTCGGCTCGC
TGTGCTTCGCGTCGATATGGGGATACCAGGCCGAGGTCGCGCGCGCGCTGCTCGCGCTGTCGCTGAGCTG
GGCCGCGCTCGAGGGCGGCCTCGTGCTCGCGTCCCAGCTCAACGCGCTCTCGGCGATCGCCCTGATCGCG
ATGACGCTCGGCGGGCGCGGCCCGTATGCGTGGCATCACGACGGCCACGGCGTCTGGGCGCTGCAGGTCG
ATCTGATCGGCGTCGCGATCCTGTCGATGTGCATCGCGATCGCGACGGGCGAGCGGCGGCGGCTTGCGCG
GCAGATCGAACGATCGCGCCGTTTCGAGTCGCTCGGCTTTTTCGCCGGCGGAATCGTGCACGATTTCAGC
AACGTGCTGACGACGATCGATTGCCACGCCGAATACGCGTCCGAGCGGCTCGCGAGCGGCGCGCGCGCGG
ACGATTCGATCGACGAGATTCATCGCGCGGTCGAACGCGGCCGCGATCTGGCGGCGCAGATCCTGCTCGC
CGCGCGCCGCGGCGAGCCCGTGCTGACGCGGGTGAGTGTCGACGAGGTCGTCGACGAGGCGCTCGCCGCG
ACACGCGCGGCCGCGTGGCGCGGCGTCGAGATCGTTCGATGCGGCGATGGCGCGCGCGACGGCGCCCGGC
GTGGCGACGTTCGTCACGTCGTATTCGCCGACCGCAGCCAGCTCGCGCGCGCGGTCATGAATCTCGTCGG
CAATGCGGTGCGCGCGGCGCGCGCGACGGTTGTCGTGCGTGTCGGGGTGAACGGCGGGGTGAACGGCGGC
GCGAGCGATGGGGCGAGCCGCGGCGCGAACGACGGCGGCGCGCCGGCCGCTCGCGCATTCGACGTCGCGA
TCGGCGAAGCGTCGATGCCGGGCGGCGTGTGGATCGAGGTGAGCGACGACGGCGAAGGCATCGACGTCGA
GCCGCTCGACCGCATCTTCGAGCCGTTCTATTCGAACCGCTCCGGCGCGCCGGGGACGGGGCTGGGTCTC
GCGATCGTCGCGGGCGCGGCGCTCGCGCACCGCGGGCAGATCGCCGTCGCGACGGATCGGGGCGTGGGCA
GTTGCTTCCGGTTCACGTTGCCGGCGGCATGGGGAACGGGCGCGCCCGGCGCAATGGACGCCGGCGGGCC
CAGCGCAGTACAGGAGAGGCAATGA