SecReT6
Protein ID: 526457193
SecReT6 ID829
T6SS typei3
Gene symbol-
Locus tagBDL_3747
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]270790..272652 [+]
Producthypothetical protein
NoteTssF
UniProt IDS5P499
KEGG IDbpse:BDL_3747
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-127, Aligned region: 3..605
Protein Sequence: 620 a.a.     [Download]
>gi|526457193|ref|YP_008327533.1| hypothetical protein BDL_3747 [Burkholderia pseudomallei MSHR305]
MNFLDHYNDELRQLRDAGARFSKEHPQVASALGLHPDAVTDPFVERLLEGVAYLSARVQKRLDRECAEFA
QQALGRICPLYTASTPAISTFAFHPDLGSPDAFRGNTLPRGSLIAAHLPGRKLPVMFSTAREVTLLPLRL
ASVECSRSITGLPSLLAQRLASSHAVLRFRFEIEGGASIAELAREDDGFKPLHLSVAGDLPRAYALHRAL
LADTTAWYALVSTNRGDEVLPLPMSGIRLSGVDDEEALLPEAFGGLPGLRLLREYFAQPTRLLGVYVDAL
AAIAAKAPSARAFDLFFALRDAPGDLVGDVDASQFRLFATPAINLYSKRFDPVPYDANQPEQWIPVDRMR
PAAHHLWALTEVFVCETNGRAHRARSVLETAGYEGHEGSIRYGMRREDALLVDGVRRDRFDPLASHDLIA
VSMVDDTLEPDDVATITGRALVADRDWRPSALLDAELQLLDPTAVKRIECLWPASAPRGKPSIDACWEAV
SHVGRNPLALRASQQQDVTARIVEQLLLAIDKDDALDRQRLESLRSVVLRSRFVAAGRATPTALVRATQV
EIDIAESLHADRGGWLFGRLLAQALAEAATLNDGIEIVVRLDGEAASTHTNVATRDGRLA
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|526456747|ref|NC_021877.1|:270790-272652 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGAACTTCCTCGATCACTACAACGACGAATTGCGCCAGTTGCGCGATGCGGGCGCACGCTTCTCCAAGG
AGCACCCGCAGGTGGCCTCCGCGCTCGGGCTGCATCCGGATGCGGTCACCGATCCGTTCGTCGAGCGCCT
GCTCGAGGGCGTCGCGTACCTGTCGGCGCGCGTGCAGAAGCGGCTCGATCGCGAGTGCGCGGAGTTCGCG
CAGCAGGCGCTCGGGCGCATCTGCCCGCTCTACACGGCTTCCACGCCCGCGATCTCGACGTTCGCGTTCC
ATCCCGATCTCGGCTCGCCCGATGCGTTTCGCGGCAACACGCTGCCGCGCGGCTCGCTCATCGCCGCGCA
CCTGCCCGGGCGCAAGCTGCCGGTGATGTTCTCGACCGCGCGCGAGGTCACGCTGCTGCCGCTGCGTCTC
GCATCGGTCGAGTGCAGCCGCAGCATCACCGGGCTGCCGTCGCTGCTCGCGCAGCGGCTCGCCTCGTCGC
ACGCGGTGCTGCGCTTCAGGTTCGAGATCGAGGGCGGCGCGTCGATCGCGGAGCTCGCGCGCGAGGACGA
CGGCTTCAAGCCGCTGCATCTGAGCGTGGCGGGCGATCTGCCGCGCGCATATGCGCTGCACCGCGCGCTG
CTCGCCGACACCACCGCGTGGTACGCGCTCGTGTCGACGAACCGCGGTGACGAGGTGCTGCCGTTGCCGA
TGTCGGGCATCCGGCTGTCCGGCGTCGACGACGAGGAGGCGCTGCTGCCCGAGGCGTTCGGCGGGCTGCC
CGGCCTGCGGCTGCTGCGCGAGTACTTCGCGCAGCCCACGCGGCTGCTCGGCGTCTACGTCGACGCGCTG
GCGGCGATCGCCGCGAAGGCGCCGTCCGCGCGCGCGTTCGATCTGTTCTTCGCGTTGCGCGACGCGCCGG
GCGATCTGGTGGGCGACGTCGACGCGAGCCAGTTCCGCCTGTTCGCGACGCCGGCGATCAATCTGTATTC
CAAACGTTTCGACCCGGTGCCGTACGACGCGAATCAGCCCGAGCAGTGGATTCCCGTCGACCGGATGCGG
CCCGCCGCGCATCACCTGTGGGCGCTCACCGAGGTGTTCGTGTGCGAGACCAACGGTCGCGCGCACCGCG
CGCGCTCGGTGCTCGAGACGGCGGGCTACGAAGGGCACGAAGGCTCGATCCGCTACGGCATGCGGCGCGA
GGACGCGCTGCTCGTCGACGGCGTGCGGCGCGACCGGTTCGATCCGCTCGCGAGCCACGACCTGATCGCC
GTCTCGATGGTCGACGACACGCTCGAGCCGGACGACGTCGCGACGATCACGGGCCGCGCGCTCGTGGCCG
ATCGCGACTGGCGCCCGAGCGCTCTGCTCGACGCCGAGCTGCAACTGCTCGATCCGACCGCGGTCAAGCG
CATCGAGTGCCTGTGGCCGGCGAGCGCGCCGCGCGGCAAGCCGAGCATCGACGCGTGCTGGGAGGCGGTC
TCGCACGTCGGGCGCAACCCGCTCGCGCTGCGCGCGTCGCAGCAGCAGGACGTGACGGCGCGCATCGTCG
AGCAGTTGCTGCTCGCGATCGACAAGGACGACGCGCTCGATCGCCAGCGGCTCGAGAGCCTGCGCTCGGT
CGTGCTGCGCTCGCGCTTCGTCGCGGCGGGGCGCGCCACGCCCACCGCGCTGGTGCGCGCGACACAGGTG
GAGATCGACATCGCCGAATCGCTGCACGCCGATCGCGGCGGCTGGCTGTTCGGGCGGCTGCTCGCGCAGG
CGCTCGCGGAGGCCGCCACGCTCAACGACGGCATCGAGATCGTGGTGCGCCTGGACGGCGAAGCGGCGAG
CACGCACACGAACGTCGCCACGCGCGACGGGAGGCTCGCATGA